Dataset for protein Bcl-2 of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A673HVU7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL-2 (length=229 residues).
MATEIRFDNRNIVEKYINHKLSKKGYVWKSQSSGEDDDTANKGIEGSSLNSGRRLQAPSAGGGNNSECLIAHRVTRSDPY
SRIYRALREAGDEIERLYQREFEEMSHRMIFSPNTTQRSFLAVAEELFKDGVNWGRIIAFFEFGGTMCVESVNREMASQV
DNIAHWMTDYLNGPLENWIEENGGWDAFVELYSQQRDSVFHPFSYLTKVLGLAVLGLAGVTIGAFFAQK
>gnl|bcl2dbpro|A0A673LV42_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL-2 (length=223 residues).
MAQENVYDNRSIVVKYIHHKLWKKGYVWEVNGHDDSVSNGLMMERREDGGISPSSRHDPCRALHKVLSRHDPCRALHKVL
REAGDELERLYQSDFAEMSKRLHLTSITAHQRFTAVIDELFGDGVNWGRIIAFFEFGGTVCVECVNKEMMAHVDNIAGWM
TEYLNGPLHGWIQENGGWEAFVELYGRQRDSVFRSSWSSIVTVFGLAALGAVGLTIGAYLAQK
© 1998-2020Legal notice