Dataset for protein Bcl-2 of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673HVU7_BCL2-01      MATEIRFDNRNIVEKYINHKLSKKGYVWKSQSSGEDDDTANKGIEGSSLN
A0A673LV42_BCL2-01      MAQENVYDNRSIVVKYIHHKLWKKGYVW--EVNGHDDSVSN------GLM
                        ** *  :***.** ***:*** ******  : .* **..:*      .* 

A0A673HVU7_BCL2-01      SGRRLQAPSAGGGNNSECLIAHRV-TRSDPYSRIYRALREAGDEIERLYQ
A0A673LV42_BCL2-01      MERREDGGISPSSRHDPCRALHKVLSRHDPCRALHKVLREAGDELERLYQ
                          ** :.  : ...:. *   *.* :* **   ::..*******:*****

A0A673HVU7_BCL2-01      REFEEMSHRMIFSPNTTQRSFLAVAEELFKDGVNWGRIIAFFEFGGTMCV
A0A673LV42_BCL2-01      SDFAEMSKRLHLTSITAHQRFTAVIDELFGDGVNWGRIIAFFEFGGTVCV
                         :* ***:*: ::. *::. * ** :*** *****************:**

A0A673HVU7_BCL2-01      ESVNREMASQVDNIAHWMTDYLNGPLENWIEENGGWDAFVELYSQQRDSV
A0A673LV42_BCL2-01      ECVNKEMMAHVDNIAGWMTEYLNGPLHGWIQENGGWEAFVELYGRQRDSV
                        *.**.** ::***** ***:****** .**:*****:******..*****

A0A673HVU7_BCL2-01      FH-PFSYLTKVLGLAVLGLAGVTIGAFFAQK
A0A673LV42_BCL2-01      FRSSWSSIVTVFGLAALGAVGLTIGAYLAQK
                        *. .:* :..*:***.** .*:****::***

© 1998-2020Legal notice