Dataset for protein Mcl-1 of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A671L9M9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=MCL-1 (length=247 residues).
MFPGSKVSNDSGFWPCIGIAALNVNNSSSGFSRKPLVMPELKAQNQFTGNGLQGSVPSSPETDCEEIDDYTSIYAALEMD
TREIIDAFLKSFTGLSHYKSGKKQVLSTMKGVVDSLAVKHELAYKGMIARLNLEQKGEDVRFVKTVATELFSDGITNWGR
ICSLLTFGAMVCKHQNDRGLGKCVSLVGEEISSYLLTDQRDWLLKNKAWDGFVEFFHVPDTEAAMRSTLMVIGGVATFGA
ALAYLIR
>gnl|bcl2dbpro|A0A671LAP7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=MCL-1 (length=230 residues).
MTLSLGNRPMAALGVLAEEADAALKPLRPGTNGLKGLQLDGRFVSAGDGSLPATPDPQELGSDTRQLLLDFYRTHTGMSL
PDRKRHHALPTMKRVVADVVIKHQITYRGMLQHLQLDSQPDDLSFIGCIAKTMFRDDTTNWGRIVSLVAFGAVVCSRLKE
LQRERCVETVAQQISSYLISEQHDWLLNNKGWHGFVEFFRVEDVESVVRSALMAVVGCAGIGAGLALLIR
>gnl|bcl2dbpro|A0A671LEY4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=MCL-1 (length=260 residues).
MTLSLVRRTAAVSLLGAHTALVPAAALKARSEDELDGCADEPDAAGKPVRPGANGLRGLQLDGRFVSAADGSLPSTPDPQ
ELGSAELDRDTRQLLLDFYRTHTGMCPQDRKQHHALPTMTQVVADILLKHEIAYKGMLQRLQLESQADDMSFISCIAETM
FNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVAQQISSYLISEQHDWLLNNKGWHGFVEFFCVEDVESVIRNALM
AVVGCAGIGAGLLFKNNCEV
>gnl|bcl2dbpro|A0A671RQ00_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=MCL-1 (length=248 residues).
MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMPERKPQNQFTGNGLQGSVPSSPKPDCEEVQDEYTSIYDALEM
DTREIIDIFLKNFTGFPHSKSGNKQVLATMNRVVESLVMKHELVYKGMIARLNLEQKGEDVSFVKTVATELFSDGITNWG
RIASLLTFGAMVSKHQNDKGLSKCVSLVGKEISSYLLTTQRDWLLKNKAWDGFVEFFHVPNTEAAVRNTLMAIGSVATFG
AALAYLTR
© 1998-2020Legal notice