Dataset for protein Mcl-1 of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671LAP7_MCL1-01      ----------------------MTLSLGNRPMAALGVLAEEADAALKPLR
A0A671LEY4_MCL1-01      MTLSLVRRTAAVSLLGAHTALVPAAALKARSEDELDGCADEPDAAGKPVR
A0A671L9M9_MCL1-01      --------MFPGSKVSNDSGFWPCIGIAALNVNNSSSGFSRKPLV-MPEL
A0A671RQ00_MCL1-01      --------MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLV-MPER
                                                 .:        .        .  *  

A0A671LAP7_MCL1-01      PGTNGLKGLQLDGRFVSAGDGSLPATPDP-----QELGSDTRQLLLDFYR
A0A671LEY4_MCL1-01      PGANGLRGLQLDGRFVSAADGSLPSTPDPQELGSAELDRDTRQLLLDFYR
A0A671L9M9_MCL1-01      KAQNQFTGNGLQGSVPSSPETDCEEI-DDYTSIYAALEMDTREIIDAFLK
A0A671RQ00_MCL1-01      KPQNQFTGNGLQGSVPSSPKPDCEEVQDEYTSIYDALEMDTREIIDIFLK
                           * : *  *:* . *: . .     *        *  ***:::  * .

A0A671LAP7_MCL1-01      THTGMSLPDRKRHHALPTMKRVVADVVIKHQITYRGMLQHLQLDSQPDDL
A0A671LEY4_MCL1-01      THTGMCPQDRKQHHALPTMTQVVADILLKHEIAYKGMLQRLQLESQADDM
A0A671L9M9_MCL1-01      SFTGLSHYKSGKKQVLSTMKGVVDSLAVKHELAYKGMIARLNLEQKGEDV
A0A671RQ00_MCL1-01      NFTGFPHSKSGNKQVLATMNRVVESLVMKHELVYKGMIARLNLEQKGEDV
                        ..**:   .  .::.*.**. ** .: :**::.*.**: .*:*:.: :*:

A0A671LAP7_MCL1-01      SFIGCIAKTMFRDDTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVAQQ
A0A671LEY4_MCL1-01      SFISCIAETMFNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVAQQ
A0A671L9M9_MCL1-01      RFVKTVATELFSDGITNWGRICSLLTFGAMVCKHQNDRGLGKCVSLVGEE
A0A671RQ00_MCL1-01      SFVKTVATELFSDGITNWGRIASLLTFGAMVSKHQNDKGLSKCVSLVGKE
                         *:  :*  :* *. ****** **::***:*... ::    .**. *.::

A0A671LAP7_MCL1-01      ISSYLISEQHDWLLNNKGWHGFVEFFRVEDVESVVRSALMAVVGCAGIGA
A0A671LEY4_MCL1-01      ISSYLISEQHDWLLNNKGWHGFVEFFCVEDVESVIRNALMAVVGCAGIGA
A0A671L9M9_MCL1-01      ISSYLLTDQRDWLLKNKAWDGFVEFFHVPDTEAAMRSTLMVIGGVATFGA
A0A671RQ00_MCL1-01      ISSYLLTTQRDWLLKNKAWDGFVEFFHVPNTEAAVRNTLMAIGSVATFGA
                        *****:: *.****:**.* ****** * :.*:.:*.:**.: . * :**

A0A671LAP7_MCL1-01      GLALLIR---
A0A671LEY4_MCL1-01      GLLFKNNCEV
A0A671L9M9_MCL1-01      ALAYLIR---
A0A671RQ00_MCL1-01      ALAYLTR---
                        .*    .   

© 1998-2020Legal notice