Dataset for protein Bcl-xL of organism Salmo trutta

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A673Z4J6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo trutta GN=BCL2L1 (length=216 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDEAIANGSVGNSRSNLAKPSSPQGGMEPVKAALRDSVDEFEL
RYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQ
PWIQSQGGWDRFAEIFGRDAAADVRRSQESIIKWLLAGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|A0A674C337_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo trutta GN=BCL2L1 (length=228 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEGGQVEGGAAVITYVNGTSPGTPPPRQSPPSSPRRTAGLDAVK
EALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFSFGGALCVECVDKEMNPLVGRIT
DWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWLLAGMTLVTGVVVGSIFAQKRL
>gnl|bcl2dbpro|A0A674C4N2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo trutta GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGKPSSPQGGIEAVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSHLVMRIADWMATYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESLRKWLLVGVMLLSGVLVGTLIMKKCQ
>gnl|bcl2dbpro|A0A674C578_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Salmo trutta GN=BCL2L1 (length=231 residues).
IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQAEGGAAVTTHPNGAANGTSPGTPPRQSPPSSPQRTMGLD
AVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVG
RIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A674C578_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo trutta GN=BCL2L1 (length=230 residues).
MCINLSELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQAEGGAAVTTHPNGAANGTSPGTPPRQSPPSSPQRTMGLDA
VKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGR
IADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
© 1998-2020Legal notice