Dataset for protein Bcl-xL of organism Salmo trutta

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673Z4J6_BCL2L1-      -MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDEA--------
A0A674C337_BCL2L1-      MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEGGQVEGGAAVIT
A0A674C578_BCL2L1-      -MCINLSELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQAEGGAAVTT
A0A674C4N2_BCL2L1-      -MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGN
A0A674C578_BCL2L1-      IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQAEGGAAVTT
                         *  .  ****::*:*.****:*.  :: *  * .****.:.        

A0A673Z4J6_BCL2L1-      ----IANGSVGNSRSNLAKPSSPQG--GMEPVKAALRDSVDEFELRYTRA
A0A674C337_BCL2L1-      YVNGTSPGTP---PPRQSPPSSPRRTAGLDAVKEALRDSANEFELRYARA
A0A674C578_BCL2L1-      HPNGAANGTSPGTPPRQSPPSSPQRTMGLDAVKEALRDSANEFELRYARA
A0A674C4N2_BCL2L1-      NRNGRSNLGKPSSPQG-----------GIEAVKAALRDSVDEFELRYTRA
A0A674C578_BCL2L1-      HPNGAANGTSPGTPPRQSPPSSPQRTMGLDAVKEALRDSANEFELRYARA
                             :                     *::.** *****.:******:**

A0A673Z4J6_BCL2L1-      FSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVEC
A0A674C337_BCL2L1-      FSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFSFGGALCVEC
A0A674C578_BCL2L1-      FSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVEC
A0A674C4N2_BCL2L1-      FSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVEC
A0A674C578_BCL2L1-      FSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVEC
                        ************:***:***.*******************:*********

A0A673Z4J6_BCL2L1-      VEKDMSPLVARIADWMTTYLDNHIQPWIQSQGGWDRFAEIFGRDAAADVR
A0A674C337_BCL2L1-      VDKEMNPLVGRITDWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESR
A0A674C578_BCL2L1-      VEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESR
A0A674C4N2_BCL2L1-      VEKDMSHLVMRIADWMATYLDNHIQPWIQSQGGWDRFAEIFGRDAAADVR
A0A674C578_BCL2L1-      VEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESR
                        *:*:*. ** **:***:.************************ ****: *

A0A673Z4J6_BCL2L1-      RSQESIIKWLLAGVILLSGVLVGTLIMKKRQ
A0A674C337_BCL2L1-      KSQESFKKWLLAGMTLVTGVVVGSIFAQKRL
A0A674C578_BCL2L1-      KSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
A0A674C4N2_BCL2L1-      RSQESLRKWLLVGVMLLSGVLVGTLIMKKCQ
A0A674C578_BCL2L1-      KSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
                        .****: ****.*: *::**:**::: :*  

© 1998-2020Legal notice