Dataset for protein Bcl-2 of organism Salmo trutta

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A673Z0A3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo trutta GN=BCL-2 (length=230 residues).
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFNPENDSPNNGFGEPSPPNSPEVFARRSQPSAEGVDTESQLPNRIPQPDR
HARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRFTAVIEELFRDGVNWGRIVAFFEFGGTMCVESVNREMTTQ
VDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQRISVFHSWPYLKTVFGLAALGAAGVTIGALFIQK
>gnl|bcl2dbpro|A0A674B0E5_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo trutta GN=BCL-2 (length=226 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRLGLARRCHGANNAGPGSVPSLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLSWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A674B8T7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo trutta GN=BCL-2 (length=228 residues).
MMANENPYNSRFIVEKYIHHKLLNMGFVWKFQAENDSPNNGFGDPSTPNSPEVFARRSQPTAAGEDTDPPYQNRSPQPDP
HARLHRVLREAGGEIERMYQRDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIARWMMEYLNGPLQNWIQENGGWDAFVEIYEQQRISHSWPYLKTVFGLAALGAAGVTIGALFTQK
© 1998-2020Legal notice