Dataset for protein Bcl-2 of organism Salmo trutta

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673Z0A3_BCL2-01      MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFNPENDSPNNGFGEPSPPNS
A0A674B8T7_BCL2-01      MMANENPYNSRFIVEKYIHHKLLNMGFVWKFQAENDSPNNGFGDPSTPNS
A0A674B0E5_BCL2-01      MANDDN----RFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPR
                        *  ::*    ******** ****: *:.*.*:  ::. . . . .  .  

A0A673Z0A3_BCL2-01      PEVFARRSQPSAEGVDTESQLPNRIPQPDRHARLHRVLREAGDEIEIMYQ
A0A674B8T7_BCL2-01      PEVFARRSQPTAAGEDTDPPYQNRSPQPDPHARLHRVLREAGGEIERMYQ
A0A674B0E5_BCL2-01      LGLARRCHGANNAGPGSVPSLSKWLSQPDPHAAIHRVLREAGDELERLYQ
                          :  *   ..  * .: .   :. .*** ** :********.*:* :**

A0A673Z0A3_BCL2-01      RDFAEMSGQLHFTPSTAQRRFTAVIEELFRDGVNWGRIVAFFEFGGTMCV
A0A674B8T7_BCL2-01      RDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCV
A0A674B0E5_BCL2-01      PDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICV
                         ****** **::*.***:***  **:*** ********:********:**

A0A673Z0A3_BCL2-01      ESVNREMTTQVDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQRISV
A0A674B8T7_BCL2-01      ESVNREMTSQVDNIARWMMEYLNGPLQNWIQENGGWDAFVEIYEQQRIS-
A0A674B0E5_BCL2-01      ECVNKEMTSQVDHIAVWMTEYLNGPLLSWIQENGGWEAFVELYDRQRDSV
                        *.**.***:***:** ** ******* .******.*:****:* .** * 

A0A673Z0A3_BCL2-01      FHSWPYLKTVFGLAALGAAGVTIGALFIQK
A0A674B8T7_BCL2-01      -HSWPYLKTVFGLAALGAAGVTIGALFTQK
A0A674B0E5_BCL2-01      FCSWPSIKTVFGLAALGAASLTIGAYLTQK
                          *** :************.:**** : **

© 1998-2020Legal notice