Dataset for protein Mcl-1 of organism Salmo salar

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A1S3NR66_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo salar GN=MCL-1 (length=287 residues).
MSLSFTRATTTILNFQNGVVGGSSYPAGTPLCYFGETVCAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHM
SDRSNDDDSDGSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYIGLSPPRWKQSKALTTMTRVVKDIIAKH
QYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQR
DWLVKNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIR
>gnl|bcl2dbpro|A0A1S3NR66_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo salar GN=MCL-1 (length=274 residues).
VKMSLSFTRATTTILNFQNGVVGGSSYPAGTPLCYFGETVCAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGN
HMSDRSNDDDSDGSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYIGLSPPRWKQSKALTTMTRVVKDIIA
KHQYAYNDLFFLGMITLFSDGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLVKNNAWNGFV
EFFHVQDPESSVRNALIAFAGFAGLGATLAMLIR
>gnl|bcl2dbpro|Q0KFR9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo salar GN=MCL-1 (length=285 residues).
MSLSNSITRATTTMLHFQNGGSSYLADDARPLYYFQGAGAICAGASPKSKVDLGNGTGDTPPRPTTLGVNVVKSNGLDNH
LSDRSNNDDSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENFLGDYTGLSQPRWTQSKPLTTMKRVVEDVIAKHRY
AYNGMVAKLDLDDRCDDMGVINSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDW
LIKNNAWNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMFIR
© 1998-2022Legal notice