Dataset for protein Mcl-1 of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1S3NR66_MCL1-02      VKMSLSFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
A0A1S3NR66_MCL1-01      MSL--SFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
Q0KFR9_MCL1-01          MSLSNSITRATTTMLHFQN---GGSSYLADDARPLYYFQGAGAICAGASP
                        :.:  *:******:*:***   ***** *  . ** **  . ::******

A0A1S3NR66_MCL1-02      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHMSDRSNDDDSDGSLP
A0A1S3NR66_MCL1-01      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHMSDRSNDDDSDGSLP
Q0KFR9_MCL1-01          KSKV--DLGNGTGDTPPRPTTLGVNVVKSNGLDNHLSDRSNNDD---SLP
                        ****  **************.********* *.**:*****:**   ***

A0A1S3NR66_MCL1-02      CTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYIGLSPPRWKQSK
A0A1S3NR66_MCL1-01      CTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYIGLSPPRWKQSK
Q0KFR9_MCL1-01          CTPQMASECGPELSNCPSGDEVLEHDTRQLIENFLGDYTGLSQPRWTQSK
                        *********************************:**** *** ***.***

A0A1S3NR66_MCL1-02      ALTTMTRVVKDIIAKHQYAYNDLFF----------LGMI-----TLFSDG
A0A1S3NR66_MCL1-01      ALTTMTRVVKDIIAKHQYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDG
Q0KFR9_MCL1-01          PLTTMKRVVEDVIAKHRYAYNGMVAKLDLDDRCDDMGVINSVAKTMFSDG
                        .****.***:*:****.****.:.           :..*     *:****

A0A1S3NR66_MCL1-02      TTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLV
A0A1S3NR66_MCL1-01      TTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLV
Q0KFR9_MCL1-01          ITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDWLI
                         ******************.*** *****:*****:**.****** ***:

A0A1S3NR66_MCL1-02      KNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIR
A0A1S3NR66_MCL1-01      KNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIR
Q0KFR9_MCL1-01          KNNAWNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMFIR
                        ***********************:*:****.**:******:**

© 1998-2020Legal notice