Dataset for protein Mcl-1 of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q0KFR9_MCL1-01          MSLSNSITRATTTMLHFQN---GGSSYLADDARPLYYFQGAGAICAGASP
A0A1S3NR66_MCL1-02      VKMSLSFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
A0A1S3NR66_MCL1-01      --MSLSFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
                          :* *:******:*:***   ***** *  . ** **  . ::******

Q0KFR9_MCL1-01          KSKV--DLGNGTGDTPPRPTTLGVNVVKSNGLDNHLSDRSNNDD---SLP
A0A1S3NR66_MCL1-02      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHMSDRSNDDDSDGSLP
A0A1S3NR66_MCL1-01      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHMSDRSNDDDSDGSLP
                        ****  **************.********* *.**:*****:**   ***

Q0KFR9_MCL1-01          CTPQMASECGPELSNCPSGDEVLEHDTRQLIENFLGDYTGLSQPRWTQSK
A0A1S3NR66_MCL1-02      CTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYIGLSPPRWKQSK
A0A1S3NR66_MCL1-01      CTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYIGLSPPRWKQSK
                        *********************************:**** *** ***.***

Q0KFR9_MCL1-01          PLTTMKRVVEDVIAKHRYAYNGMVAKLDLDDRCDDMGVINSVAKTMFSDG
A0A1S3NR66_MCL1-02      ALTTMTRVVKDIIAKHQYAYN-------------DLFFLGMI--TLFSDG
A0A1S3NR66_MCL1-01      ALTTMTRVVKDIIAKHQYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDG
                        .****.***:*:****.****             *: .:. :  *:****

Q0KFR9_MCL1-01          ITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDWLI
A0A1S3NR66_MCL1-02      TTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLV
A0A1S3NR66_MCL1-01      TTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLV
                         ******************.*** *****:*****:**.****** ***:

Q0KFR9_MCL1-01          KNNAWNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMFIR
A0A1S3NR66_MCL1-02      KNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIR
A0A1S3NR66_MCL1-01      KNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIR
                        ***********************:*:****.**:******:**

© 1998-2021Legal notice