Dataset for protein Bcl-xL of organism Salarias fasciatus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A672IDC1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salarias fasciatus GN=BCL2L1 (length=252 residues).
MSENRELVVFYITYKLSQRNYPLNHIVLNEPPSRTDGGDGGDAGDAGSGPDQRTETHANGTFTSRSSGSPPPSPLRQLGA
GGGGGAGGGGGAGGGGGAGLDAVKEALRDTANEFELRYSMAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGL
FAFGGALCVECVEKEMSPLVGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAEGRRSEESFRKWLLVGMTVVTG
FVVGSLFAQKRL
>gnl|bcl2dbpro|A0A672IDC1_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Salarias fasciatus GN=BCL2L1 (length=227 residues).
MSENRELVVFYITYKLSQRNYPLNHIVLNEPPSRTDGGDGGDAGDAGSGPDQRTETHANGTFTSRSSGSPPPSPLRQLGE
ALRDTANEFELRYSMAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIVE
WMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAEGRRSEESFRKWLLVGMTVVTGFVVGSLFAQKRL
>gnl|bcl2dbpro|A0A672JL90_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salarias fasciatus GN=BCL2L1 (length=216 residues).
MSSSNRELVEFFLSHRLSQRNHPSSLLRPQDARQRTEEDQASSSASNGSVFSGSAGRSQSPRAETDPVKSALLDSADEFE
LLFKQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKDMSELVSRIADWMTMYLDENI
NFWIESQGGWEYFAEIFGRGAASEARRSREKMTRWLLVGVALLAGVLIGVGIAKRQ
© 1998-2020Legal notice