Dataset for protein Bcl-xL of organism Salarias fasciatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672JL90_BCL2L1-      MSSSNRELVEFFLSHRLSQRNHPSSLLRPQDARQRTE-------------
A0A672IDC1_BCL2L1-      -MSENRELVVFYITYKLSQRNYPLNHIVLNEPPSRTDGGDGGDAGDAGSG
A0A672IDC1_BCL2L1-      -MSENRELVVFYITYKLSQRNYPLNHIVLNEPPSRTDGGDGGDAGDAGSG
                          *.***** *::::.*****:* . :  ::. .**:             

A0A672JL90_BCL2L1-      EDQASSSASNGSVFSGSAGRSQSPR-----------------------AE
A0A672IDC1_BCL2L1-      PDQRTETHANGTFTSRSSGSPPPSPLRQLGAGGGGGAGGGGGAGGGGGAG
A0A672IDC1_BCL2L1-      PDQRTETHANGTFTSRSSGSPPPSPLRQLG--------------------
                         ** :.: :**:. * *:* . ..                          

A0A672JL90_BCL2L1-      TDPVKSALLDSADEFELLFKQAFSDLSSQLDITPDTAYHSFKSVMDEVFK
A0A672IDC1_BCL2L1-      LDAVKEALRDTANEFELRYSMAFSDLHSQLHITPATAYQSFENVMDEVFR
A0A672IDC1_BCL2L1-      -----EALRDTANEFELRYSMAFSDLHSQLHITPATAYQSFENVMDEVFR
                             .** *:*:**** :. ***** *** *** ***:**:.******.

A0A672JL90_BCL2L1-      DGVNWGRIVGLFAFGGVLCVECVEKDMSELVSRIADWMTMYLDENINFWI
A0A672IDC1_BCL2L1-      DGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIVEWMTVYLDNHIQPWI
A0A672IDC1_BCL2L1-      DGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIVEWMTVYLDNHIQPWI
                        ****************.********:** **.**.:***:***::*: **

A0A672JL90_BCL2L1-      ESQGGWEYFAEIFGRGAASEARRSREKMTRWLLVGVALLAGVLIGVGIAK
A0A672IDC1_BCL2L1-      QSQGGWERFAEIFGQDAAAEGRRSEESFRKWLLVGMTVVTGFVVGSLFAQ
A0A672IDC1_BCL2L1-      QSQGGWERFAEIFGQDAAAEGRRSEESFRKWLLVGMTVVTGFVVGSLFAQ
                        :****** ******..**:*.*** *.: .*****:::::*.::*  :*:

A0A672JL90_BCL2L1-      RQ-
A0A672IDC1_BCL2L1-      KRL
A0A672IDC1_BCL2L1-      KRL
                        .. 

© 1998-2020Legal notice