Dataset for protein Bfl1 of organism Saimiri boliviensis boliviensis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K6TLJ5_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=144 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWDLSQ
>gnl|bcl2dbpro|A0A2K6TLJ5_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2A1 (length=162 residues).
MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWGKWNSLMLMLVESAQKKKKM
AL
© 1998-2020Legal notice