Dataset for protein Bfl1 of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6TLJ5_BCL2A1-      MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEE
A0A2K6TLJ5_BCL2A1-      MTDHEFGYIHNLTQDYLRYVLQIPQSGTGPSKTSRVLQKVAFSVQKEVEE
                        **************************************************

A0A2K6TLJ5_BCL2A1-      SLKPCLDNVHIVSMDNARTIFSQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A2K6TLJ5_BCL2A1-      SLKPCLDNVHIVSMDNARTIFSQVMEKEFEDGIINWGRIVTIFAFEGILI
                        **************************************************

A0A2K6TLJ5_BCL2A1-      KKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGW----------
A0A2K6TLJ5_BCL2A1-      KKLLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWGKWNSLMLML
                        ****************************************          

A0A2K6TLJ5_BCL2A1-      --------DLSQ
A0A2K6TLJ5_BCL2A1-      VESAQKKKKMAL
                                .:: 

© 1998-2020Legal notice