Dataset for protein BCL-2-like of organism Pavo cristatus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C9EN38_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pavo cristatus GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGATVHRSSLEVHQIVRAS
DVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C9EP12_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pavo cristatus GN=MCL-1 (length=355 residues).
MFAVKRNAVIGFNLYCGGGGPGLVPASPAGDQTPPPAAAAPAAATAAEVPRPLIGSAGLWAAAGRAEAPHAPIGSEAAPH
SLTGSEEAPRAPIGSAAARRAPPDSTPRPVALWSPEEELDGCEPESERGPGGDSLPSTPPELPDELPDELRRDSLELILR
YLREAAGEAEPGVKKLFPGLLGGPGRPGRAGSAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEEDLQSVCEVAA
HVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCIGSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLESSIRNV
LMAFAGVAGLGASLAYMIRYAAGLELNPGEYLGIP
>gnl|bcl2dbpro|A0A8C9L7I6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pavo cristatus GN=BCL-2 (length=233 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPALAPAAAPAAVAAAGASSHHRPEPPGSAAASEVPPAEGL
RPAPPGVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTAHGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIATWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
© 1998-2022Legal notice