Dataset for protein BCL-2-like of organism Pavo cristatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9EP12_MCL1-01      ------MFAVKRNAVIGFNLYCGGGGPGLVPASPAGDQTPPPAAAAPAAA
A0A8C9EN38_BCL2L1-      ------MSSSNRELVIDFVSY-----------------------------
A0A8C9L7I6_BCL2-01      MAHPGRRGYDNREIVLKYIHY-----------------------------
                                  :*: *: :  *                             

A0A8C9EP12_MCL1-01      TAAEVPRPLIGSAGLWAAAGRAEAPHAPIGSEAAPHSLTGSEEAPR---A
A0A8C9EN38_BCL2L1-      -------KLSQKGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWH---P
A0A8C9L7I6_BCL2-01      -------KLSQRGYDWAAGEDRPPVPPALAPAAAPAAVAAAGASSHHRPE
                                *   .  *:         .  .. *   ::  .  : .    

A0A8C9EP12_MCL1-01      PIGSAAARRAPPDSTPRPVALWSPEEELDGCEPESERGPGGDSLPSTPPE
A0A8C9EN38_BCL2L1-      PAGHVVNGATVHRSS-----------------------------------
A0A8C9L7I6_BCL2-01      PPGSAAASEVPPAEG-----------------------------------
                        * * ..   .   .                                    

A0A8C9EP12_MCL1-01      LPDELPDELRRDSLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRAG
A0A8C9EN38_BCL2L1-      --------------------LEVHQIVRASDVRQ----------------
A0A8C9L7I6_BCL2-01      --------------------LR----PAPPGVHL----------------
                                            *        ..*.                 

A0A8C9EP12_MCL1-01      SAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEEDLQSVCEVAAH
A0A8C9EN38_BCL2L1-      ---------ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNE
A0A8C9L7I6_BCL2-01      ---------ALRQAGDEFSRRYQRDFAQMSGQLHLTPFTAHGRFVAVVEE
                                 :** .** .  .:   *  :  :* :.       .  *.  

A0A8C9EP12_MCL1-01      VFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCIGSLAGIITDALVSSK
A0A8C9EN38_BCL2L1-      LFHDGV-NWGRIVAFFSFGGALCVESVDKEMRVLVGRIVSWMTTYLTDHL
A0A8C9L7I6_BCL2-01      LFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVDNIATWMTEYLNRHL
                        :* *** ****:*:::.**. :.    . :    :. :.  :*  *    

A0A8C9EP12_MCL1-01      REWLMSQGGWEGFVDFF------RVEDLESSIRNVLMAFAGVAGLGASLA
A0A8C9EN38_BCL2L1-      DPWIQENGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGV-----
A0A8C9L7I6_BCL2-01      HNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKT-ILSLVLVGAC-----
                          *: .:***: **:::       .     ::.. ::: . *..      

A0A8C9EP12_MCL1-01      YMIRYAAGLELNPGEYLGIP
A0A8C9EN38_BCL2L1-      ----------LLLGSLLSRK
A0A8C9L7I6_BCL2-01      ----------ITLGAYLGHK
                                  :  *  *.  

© 1998-2022Legal notice