Dataset for protein Mcl-1 of organism Oryzias latipes

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3B3IJ04_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=285 residues).
MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPDPSDQLKRPQDLEYSARRFHDVDDDGSLPNTP
ELECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDD
MSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVS
DPETTVRNTLVAFLGIAGVGALLAQLNMMAIFKGLPASTRLHNSR
>gnl|bcl2dbpro|A0A3B3IJ04_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=268 residues).
MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPDPSDQLKRPQDLEYSARRFHDVDDDGSLPNTP
ELECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDD
MSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVS
DPETTVRNTLVAFLGIAGVGALLAQLSR
>gnl|bcl2dbpro|A0A3P9ILF6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=267 residues).
MFPLQKQMVNSYITSNCGFTGHILGRAGEMSARVPLPSTLASRVANPDPSDQFKRPQDLEYSARRFHDVDDDGSLPNTPE
LECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYPHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDDM
SFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSD
PETTVRNTLVAFLGIAGVGALLAQLSR
>gnl|bcl2dbpro|A0A3P9ILF6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=284 residues).
MFPLQKQMVNSYITSNCGFTGHILGRAGEMSARVPLPSTLASRVANPDPSDQFKRPQDLEYSARRFHDVDDDGSLPNTPE
LECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYPHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDDM
SFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSD
PETTVRNTLVAFLGIAGVGALLAQLNMMAIFKGLPASARLHNSR
>gnl|bcl2dbpro|A0A3P9L1F3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=285 residues).
MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASRVANPDPSDQLKRPQDLEYSARRFHDVDDDGSLPNTP
ELECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDD
MSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVS
DPESTVRNTLVAFLGIAGVGALLAQLNMMAIFKGLPASARLHNWR
>gnl|bcl2dbpro|A0A3P9L1F3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=268 residues).
MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASRVANPDPSDQLKRPQDLEYSARRFHDVDDDGSLPNTP
ELECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDD
MSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVS
DPESTVRNTLVAFLGIAGVGALLAQLSR
© 1998-2020Legal notice