Dataset for protein Mcl-1 of organism Oryzias latipes

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3IJ04_MCL1-01      MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPDP
A0A3P9L1F3_MCL1-01      MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASRVANPDP
A0A3B3IJ04_MCL1-02      MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPDP
A0A3P9L1F3_MCL1-02      MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASRVANPDP
A0A3P9ILF6_MCL1-01      MFPLQKQMVNSYITSNCGFTGHILG-RAGEMSARVPLPSTLASRVANPDP
A0A3P9ILF6_MCL1-02      MFPLQKQMVNSYITSNCGFTGHILG-RAGEMSARVPLPSTLASRVANPDP
                        ************************* *****************.******

A0A3B3IJ04_MCL1-01      SDQLKRPQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGIDALNE
A0A3P9L1F3_MCL1-01      SDQLKRPQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGIDALNE
A0A3B3IJ04_MCL1-02      SDQLKRPQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGIDALNE
A0A3P9L1F3_MCL1-02      SDQLKRPQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGIDALNE
A0A3P9ILF6_MCL1-01      SDQFKRPQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGIDALNE
A0A3P9ILF6_MCL1-02      SDQFKRPQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGIDALNE
                        ***:**********************************************

A0A3B3IJ04_MCL1-01      DTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIV
A0A3P9L1F3_MCL1-01      DTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIV
A0A3B3IJ04_MCL1-02      DTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIV
A0A3P9L1F3_MCL1-02      DTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIV
A0A3P9ILF6_MCL1-01      DTTEFLTNFFRNFVGISQYPHRDNKYMSTAKRVVNDVLEKHKITYNGMIV
A0A3P9ILF6_MCL1-02      DTTEFLTNFFRNFVGISQYPHRDNKYMSTAKRVVNDVLEKHKITYNGMIV
                        ******************* ******************************

A0A3B3IJ04_MCL1-01      RLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKG
A0A3P9L1F3_MCL1-01      RLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKG
A0A3B3IJ04_MCL1-02      RLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKG
A0A3P9L1F3_MCL1-02      RLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKG
A0A3P9ILF6_MCL1-01      RLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKG
A0A3P9ILF6_MCL1-02      RLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKG
                        **************************************************

A0A3B3IJ04_MCL1-01      RGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSDPETTVRNTL
A0A3P9L1F3_MCL1-01      RGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSDPESTVRNTL
A0A3B3IJ04_MCL1-02      RGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSDPETTVRNTL
A0A3P9L1F3_MCL1-02      RGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSDPESTVRNTL
A0A3P9ILF6_MCL1-01      RGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSDPETTVRNTL
A0A3P9ILF6_MCL1-02      RGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSDPETTVRNTL
                        *******************************************:******

A0A3B3IJ04_MCL1-01      VAFLGIAGVGALLAQLSR-----------------
A0A3P9L1F3_MCL1-01      VAFLGIAGVGALLAQLSR-----------------
A0A3B3IJ04_MCL1-02      VAFLGIAGVGALLAQLNMMAIFKGLPASTRLHNSR
A0A3P9L1F3_MCL1-02      VAFLGIAGVGALLAQLNMMAIFKGLPASARLHNWR
A0A3P9ILF6_MCL1-01      VAFLGIAGVGALLAQL-----------------SR
A0A3P9ILF6_MCL1-02      VAFLGIAGVGALLAQLNMMAIFKGLPASARLHNSR
                        ****************                   

© 1998-2020Legal notice