Dataset for protein Bcl-xL of organism Oryzias latipes

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A3B3I2Q5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=217 residues).
MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDDGGETEEDHSDARNRRLVSSEDGRLRRSCPCCASMDAIKSTLKDSADEF
ERRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQ
ISPWIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3B3I2Q5_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=214 residues).
MTKWKKSWHLTYKMSCRDYPVSLLKPTDDGGETEEDHSDARNRRLVSSEDGRLRRSCPCCASMDAIKSTLKDSADEFERR
FHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISP
WIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3B3IB64_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL
>gnl|bcl2dbpro|A0A3P9I2N4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=214 residues).
MTKWKKSWHLTYKMSCRDYPVSLLKPTDDGGETEEDHSAARNGRQVSSEDGQLRRSCPCCASMDAIKSTLKDSADEFERR
FHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISP
WIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3P9I2N4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=217 residues).
MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDDGGETEEDHSAARNGRQVSSEDGQLRRSCPCCASMDAIKSTLKDSADEF
ERRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQ
ISPWIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3P9JYH1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL
>gnl|bcl2dbpro|A0A3P9MKK4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=214 residues).
MTKWKKSWHLTYKMSCRDYPVSLLKPTDDGGETEEDHSAARNGRPVSSEDCQLRRSCPCCASMDAIKSTLKDSADEFERR
FHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISP
WIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3P9MKK4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=217 residues).
MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDDGGETEEDHSAARNGRPVSSEDCQLRRSCPCCASMDAIKSTLKDSADEF
ERRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQ
ISPWIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
© 1998-2020Legal notice