Dataset for protein Bcl-xL of organism Oryzias latipes

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P9MKK4_BCL2L1-      MTKWKKS---WHLTYKMSCRDYPVSLLKPTDD-----GGETEEDHSAARN
A0A3B3I2Q5_BCL2L1-      MTKWKKS---WHLTYKMSCRDYPVSLLKPTDD-----GGETEEDHSDARN
A0A3P9I2N4_BCL2L1-      MTKWKKS---WHLTYKMSCRDYPVSLLKPTDD-----GGETEEDHSAARN
A0A3B3IB64_BCL2L1-      -MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETH
A0A3P9JYH1_BCL2L1-      -MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETH
A0A3B3I2Q5_BCL2L1-      MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDD-----GGETEEDHSDARN
A0A3P9I2N4_BCL2L1-      MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDD-----GGETEEDHSAARN
A0A3P9MKK4_BCL2L1-      MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDD-----GGETEEDHSAARN
                            :..   ::: **:* *:**:. :  .:.     .**. *::*   :

A0A3P9MKK4_BCL2L1-      GRPVSSEDCQ--------LRRSCPCCASMDAIKSTLKDSADEFERRFHQG
A0A3B3I2Q5_BCL2L1-      RRLVSSEDGR--------LRRSCPCCASMDAIKSTLKDSADEFERRFHQG
A0A3P9I2N4_BCL2L1-      GRQVSSEDGQ--------LRRSCPCCASMDAIKSTLKDSADEFERRFHQG
A0A3B3IB64_BCL2L1-      ANGTFNGTTPGTPPLSPLREQQLPSTTNMDAVKEALRDTANEFELRYALA
A0A3P9JYH1_BCL2L1-      ANGTFNGTTPGTPPLSPLREQQLPSTTNMDAVKEALRDTANEFELRYALA
A0A3B3I2Q5_BCL2L1-      RRLVSSEDGR--------LRRSCPCCASMDAIKSTLKDSADEFERRFHQG
A0A3P9I2N4_BCL2L1-      GRQVSSEDGQ--------LRRSCPCCASMDAIKSTLKDSADEFERRFHQG
A0A3P9MKK4_BCL2L1-      GRPVSSEDCQ--------LRRSCPCCASMDAIKSTLKDSADEFERRFHQG
                         . . .              .. *. :.***:*.:*.*:*:*** *:  .

A0A3P9MKK4_BCL2L1-      FSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVEC
A0A3B3I2Q5_BCL2L1-      FSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVEC
A0A3P9I2N4_BCL2L1-      FSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVEC
A0A3B3IB64_BCL2L1-      FNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVEC
A0A3P9JYH1_BCL2L1-      FNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVEC
A0A3B3I2Q5_BCL2L1-      FSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVEC
A0A3P9I2N4_BCL2L1-      FSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVEC
A0A3P9MKK4_BCL2L1-      FSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVEC
                        *.:*  ****** ****.*:.*::***.*.*****:****.*********

A0A3P9MKK4_BCL2L1-      VERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQNGAAEAR
A0A3B3I2Q5_BCL2L1-      VERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQNGAAEAR
A0A3P9I2N4_BCL2L1-      VERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQNGAAEAR
A0A3B3IB64_BCL2L1-      VEKEMSPLVDRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESR
A0A3P9JYH1_BCL2L1-      VEKEMSPLVDRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESR
A0A3B3I2Q5_BCL2L1-      VERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQNGAAEAR
A0A3P9I2N4_BCL2L1-      VERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQNGAAEAR
A0A3P9MKK4_BCL2L1-      VERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQNGAAEAR
                        **.:*. **.**.**** ***::*.***:*:***: ** ::**:.***:*

A0A3P9MKK4_BCL2L1-      RFQETLKKWMLVTVALLTGLLLGVLITKKR-
A0A3B3I2Q5_BCL2L1-      RFQETLKKWMLVTVALLTGLLLGVLITKKR-
A0A3P9I2N4_BCL2L1-      RFQETLKKWMLVTVALLTGLLLGVLITKKR-
A0A3B3IB64_BCL2L1-      RSQESFKKWLLVGMTVATGVLVGSFLAQKRL
A0A3P9JYH1_BCL2L1-      RSQESFKKWLLVGMTVATGVLVGSFLAQKRL
A0A3B3I2Q5_BCL2L1-      RFQETLKKWMLVTVALLTGLLLGVLITKKR-
A0A3P9I2N4_BCL2L1-      RFQETLKKWMLVTVALLTGLLLGVLITKKR-
A0A3P9MKK4_BCL2L1-      RFQETLKKWMLVTVALLTGLLLGVLITKKR-
                        * **::***:** ::: **:*:* ::::** 

© 1998-2020Legal notice