Dataset for protein Bcl-xL of organism Oncorhynchus tshawytscha

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8C8D057_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL2L1 (length=234 residues).
IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGDEGGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPLSPQRTM
GLDAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSP
LVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A8C8D057_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL2L1 (length=233 residues).
MCINLPELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGDEGGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPLSPQRTMG
LDAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPL
VGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A8C8FJG7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL2L1 (length=228 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNCTEGGQVEGGAAVMTYVNGTSPGTPPPRQSPPSSPRRTAGLDAVK
EALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVDKEMNPLVGRIT
DWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWFLAGMTLVTGVVVGSLFAQKRL
>gnl|bcl2dbpro|A0A8C8GSY4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL2L1 (length=239 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGMPSSAQGGIEAVKAALRDSVDE
FELRYTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQFVCYPVYPRTNYIHSFQMDT
>gnl|bcl2dbpro|A0A8C8GSY4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGMPSSAQGGIEAVKAALRDSVDE
FELRYTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQ
>gnl|bcl2dbpro|A0A8C8J941_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGQTEGDEAISNGSVGNYWNSRSNLAKPSSPQGGMEPVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
© 1998-2023Legal notice