Dataset for protein Bcl-xL of organism Oncorhynchus tshawytscha

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8D057_BCL2L1-      IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGDEGGQVEGGAA
A0A8C8FJG7_BCL2L1-      MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNCT---EGGQVEGGAA
A0A8C8D057_BCL2L1-      -MCINLPELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGDEGGQVEGGAA
A0A8C8J941_BCL2L1-      -MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGQTEGDEA---ISNGS
A0A8C8GSY4_BCL2L1-      -MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEA---IANGS
A0A8C8GSY4_BCL2L1-      -MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEA---IANGS
                         *  .  ****::*:*.****:*.  :: *  * . *   *.    ...:

A0A8C8D057_BCL2L1-      VTTHPNGTVNGTSPGT-PPRQSPPLSPQRTMGLDAVKEALRDSANEFELR
A0A8C8FJG7_BCL2L1-      VMTY----VNGTSPGTPPPRQSPPSSPRRTAGLDAVKEALRDSANEFELR
A0A8C8D057_BCL2L1-      VTTHPNGTVNGTSPGT-PPRQSPPLSPQRTMGLDAVKEALRDSANEFELR
A0A8C8J941_BCL2L1-      VGNYWNSRSNLAKPSS-PQG-----------GMEPVKAALRDSVDEFELR
A0A8C8GSY4_BCL2L1-      LGNNRNGRSNLGMPSS-AQG-----------GIEAVKAALRDSVDEFELR
A0A8C8GSY4_BCL2L1-      LGNNRNGRSNLGMPSS-AQG-----------GIEAVKAALRDSVDEFELR
                        : .      *   *.: .             *::.** *****.:*****

A0A8C8D057_BCL2L1-      YARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGAL
A0A8C8FJG7_BCL2L1-      YARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGAL
A0A8C8D057_BCL2L1-      YARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGAL
A0A8C8J941_BCL2L1-      YTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGAL
A0A8C8GSY4_BCL2L1-      YTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGAL
A0A8C8GSY4_BCL2L1-      YTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGAL
                        *:******.*******:***:***.*************************

A0A8C8D057_BCL2L1-      CVECVEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAA
A0A8C8FJG7_BCL2L1-      CVECVDKEMNPLVGRITDWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAA
A0A8C8D057_BCL2L1-      CVECVEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAA
A0A8C8J941_BCL2L1-      CVECVEKDMSPLVARIADWMTTYLDNHIQPWIQSQGGWDRFAEIFGRDAA
A0A8C8GSY4_BCL2L1-      CVECVEKDMSHLVTRIADWMATYLDNHIQPWIQSQGGWDRFAEIFGRDAA
A0A8C8GSY4_BCL2L1-      CVECVEKDMSHLVTRIADWMATYLDNHIQPWIQSQGGWDRFAEIFGRDAA
                        *****:*:*. ** **:***:.************************ ***

A0A8C8D057_BCL2L1-      AESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL---------------
A0A8C8FJG7_BCL2L1-      AESRKSQESFKKWFLAGMTLVTGVVVGSLFAQKRL---------------
A0A8C8D057_BCL2L1-      AESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL---------------
A0A8C8J941_BCL2L1-      ADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ---------------
A0A8C8GSY4_BCL2L1-      ADVRRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQFVCYPVYPRTNYIHS
A0A8C8GSY4_BCL2L1-      ADVRRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQ---------------
                        *: *.****: **:*.*: *::**:**:*: :*                 

A0A8C8D057_BCL2L1-      -----
A0A8C8FJG7_BCL2L1-      -----
A0A8C8D057_BCL2L1-      -----
A0A8C8J941_BCL2L1-      -----
A0A8C8GSY4_BCL2L1-      FQMDT
A0A8C8GSY4_BCL2L1-      -----
                             

© 1998-2023Legal notice