Dataset for protein Bcl-2 of organism Oncorhynchus tshawytscha

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C8GL24_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL-2 (length=228 residues).
MMANENPYNSRFIVEKYIHHKLLKVGFVWKFQGENDSPNNGFGDPSTPNSPEVFARRSQPTAAGEDTDSPYQNSSPQPDP
HARLHRVLREAGGEIERMYQRDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIARWMTEYLNGPLQNWIQENGGWDAFVEIYEQQRISHSWSYLKTVFGLAALGAAGVTIGALFTQK
>gnl|bcl2dbpro|A0A8C8JWJ1_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL-2 (length=269 residues).
MANDDNRCIVEKYICHKLLKRGYAWDFENAEEDADNNGSMISPPPGLXRRCHGANNARPGSVPHLSKRLSQTDPHAAIHR
VLREAGDELERLYQPDFAEMSHQLYLTSSMAERRFREVIDELFRDGVNWGRIVAFFEFGGTICVECVNKEMTSQVDHIAG
WMAEYLNGPLHNWIQENGGWICRHFQRRLPRGDPPEETPQRDPPEETPQGDSQSRPPKGTPQRRPPQETPQRDPPRRPPK
GDPPRRTPQRRPPRGDTPASFEHGNTHTA
>gnl|bcl2dbpro|A0A8C8JWJ1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=BCL-2 (length=224 residues).
MANDDNRCIVEKYICHKLLKRGYAWDFENAEEDADNNGSMISPPPGLXRRCHGANNARPGSVPHLSKRLSQTDPHAAIHR
VLREAGDELERLYQPDFAEMSHQLYLTSSMAERRFREVIDELFRDGVNWGRIVAFFEFGGTICVECVNKEMTSQVDHIAG
WMAEYLNGPLHNWIQENGGWEAFVELYDRQRDSVFGSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2023Legal notice