Dataset for protein Bcl-2 of organism Oncorhynchus tshawytscha

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8GL24_BCL2-01      MMANENPYNSRFIVEKYIHHKLLKVGFVWKFQ-GENDSPNNGFGDPSTPN
A0A8C8JWJ1_BCL2-02      MANDDN----RCIVEKYICHKLLKRGYAWDFENAEEDADNNG----SMIS
A0A8C8JWJ1_BCL2-01      MANDDN----RCIVEKYICHKLLKRGYAWDFENAEEDADNNG----SMIS
                        *  ::*    * ****** ***** *:.*.*: .*:*: ***    *  .

A0A8C8GL24_BCL2-01      SPEVFARRSQPTAAGEDTDSPYQNSS-PQPDPHARLHRVLREAGGEIERM
A0A8C8JWJ1_BCL2-02      PPPGLXRRCHGANNARPGSVPHLSKRLSQTDPHAAIHRVLREAGDELERL
A0A8C8JWJ1_BCL2-01      PPPGLXRRCHGANNARPGSVPHLSKRLSQTDPHAAIHRVLREAGDELERL
                        .*  : **.: :  .   . *: ..  .*.**** :********.*:**:

A0A8C8GL24_BCL2-01      YQRDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTM
A0A8C8JWJ1_BCL2-02      YQPDFAEMSHQLYLTSSMAERRFREVIDELFRDGVNWGRIVAFFEFGGTI
A0A8C8JWJ1_BCL2-01      YQPDFAEMSHQLYLTSSMAERRFREVIDELFRDGVNWGRIVAFFEFGGTI
                        ** ****** **::*.* *:***  ****** *****************:

A0A8C8GL24_BCL2-01      CVESVNREMTSQVDNIARWMTEYLNGPLQNWIQENGGWDAFVEIYEQQ--
A0A8C8JWJ1_BCL2-02      CVECVNKEMTSQVDHIAGWMAEYLNGPLHNWIQENGGW--ICRHFQRRLP
A0A8C8JWJ1_BCL2-01      CVECVNKEMTSQVDHIAGWMAEYLNGPLHNWIQENGGWEAFVELYDRQ--
                        ***.**.*******:** **:*******:*********  :   ::..  

A0A8C8GL24_BCL2-01      -----------------------------------------------RIS
A0A8C8JWJ1_BCL2-02      RGDPPEETPQRDPPEETPQGDSQSRPPKGTPQRRPPQETPQRDPPRRPPK
A0A8C8JWJ1_BCL2-01      ---------------------------------------------RDSVF
                                                                          

A0A8C8GL24_BCL2-01      HSWSYLKTVFGLAALGAAGVTIGALFTQK-
A0A8C8JWJ1_BCL2-02      GD-PPRRTPQRRPPRGDTPASFEHGNTHTA
A0A8C8JWJ1_BCL2-01      GSWPSIKTVFGLAALGAASLTIGAYLTQK-
                         . .  .*    .. * :  ::    *:. 

© 1998-2023Legal notice