Dataset for protein Mcl-1 of organism Oncorhynchus kisutch

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C7H1W6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=MCL-1 (length=288 residues).
MSLLSSSIARATTTMLHFQNGGSSYLADDASPLYYIDGAVCAGASPKSKVDLGNGTGDTPPRPTTLGVNVVKSNVLDNHL
SDRSNNDDSLPCTPQMASECGPELLEHDTRQLIDDMLREYTGLSQPRWKQSKYLTTMKRVVEDVIAKHRYAYNGMVVKLD
LDDRCDDMSVVNSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKESGRGHCVDLVGREIATYLLSDQRDWLVKNNAWNGF
VEFFHVQDPESSVRNTLLAFAGVAGIGATLAMLIRKCPALPQGCVVCL
>gnl|bcl2dbpro|A0A8C7H1W6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=MCL-1 (length=274 residues).
MSLLSSSIARATTTMLHFQNGGSSYLADDASPLYYIDGAVCAGASPKSKVDLGNGTGDTPPRPTTLGVNVVKSNVLDNHL
SDRSNNDDSLPCTPQMASECGPELLEHDTRQLIDDMLREYTGLSQPRWKQSKYLTTMKRVVEDVIAKHRYAYNGMVVKLD
LDDRCDDMSVVNSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKESGRGHCVDLVGREIATYLLSDQRDWLVKNNAWNGF
VEFFHVQDPESSKMDYARKFSEILDSTMVGMSTQ
>gnl|bcl2dbpro|A0A8C7H400_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=MCL-1 (length=302 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTPLCYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQMASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSRCKQSKALTTMKRVVKDIIA
KHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQHLKEIGRGHCIESVGQKIATYLLSD
QRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLIRQCPALPQGCVVCL
>gnl|bcl2dbpro|A0A8C7H400_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=MCL-1 (length=293 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTPLCYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQMASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSRCKQSKALTTMKRVVKDIIA
KHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQHLKEIGRGHCIESVGQKIATYLLSD
QRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLIRNSAD
>gnl|bcl2dbpro|A0A8C7N2B4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=MCL-1 (length=320 residues).
MACPDIGNRVKATLKHLKVAGSIDSTPLFTSRGPEHEYRWGDLETDSSLAYGSKHFGVLGESANMYHLPNTVDTHKCFMC
NLEIKNFVENDTLLGEHIFHVYNTSGRCKYLTDRYTNREDEMMLLLGKERYRRGKIAFPDSIITNSTGALDTDTRQLIKC
VLGQCTGLLKPRWNESKALSTMSRVIGQLLEKHRYTYNGMINTLYVDDRGDNVKFLSAVAHSIFEDGTVNWGRVASLTSF
GAAVCRYLRGKGRDNCVDLVGEEISEYLVTHHKDWLVKHNSWNGFVEFFPVAEPESRCRNIIMTIFGLAGIGATMTFLVM
© 1998-2022Legal notice