Dataset for protein Mcl-1 of organism Oncorhynchus kisutch

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7N2B4_MCL1-01      -MACPDIGNRVKATLKHLKV---AGSI----DSTPLFTSRGPEHEYRWGD
A0A8C7H400_MCL1-01      -MSLSKSITRATTTMLNFQNGVVGGSSYPAGTPLCYFGETGAVRAGASPK
A0A8C7H400_MCL1-02      -MSLSKSITRATTTMLNFQNGVVGGSSYPAGTPLCYFGETGAVRAGASPK
A0A8C7H1W6_MCL1-01      MSLLSSSIARATTTMLHFQN---GGSSYLADDASPLYYIDGAVCAGASPK
A0A8C7H1W6_MCL1-02      MSLLSSSIARATTTMLHFQN---GGSSYLADDASPLYYIDGAVCAGASPK
                            ..   *..:*: :::    .**      .   :   *.       .

A0A8C7N2B4_MCL1-01      LETDSSLAYGSKHFGVLGESANMYHLPNTVDTHKCFMCNLEIKNFVENDT
A0A8C7H400_MCL1-01      SKVDTDLGNG---------TGDTPPRPTKLGVN------------VVKSN
A0A8C7H400_MCL1-02      SKVDTDLGNG---------TGDTPPRPTKLGVN------------VVKSN
A0A8C7H1W6_MCL1-01      SKV--DLGNG---------TGDTPPRPTTLGVN------------VVKSN
A0A8C7H1W6_MCL1-02      SKV--DLGNG---------TGDTPPRPTTLGVN------------VVKSN
                         :.  .*. *         :.:    *..:..:            * :..

A0A8C7N2B4_MCL1-01      LLGEHIFHVYNTSGRCKYLTDRYTNREDEMMLLLGKERYRRGKIAFPDSI
A0A8C7H400_MCL1-01      VLGNH-------------LSDRSNNDDSDGSLPCTPQ-------------
A0A8C7H400_MCL1-02      VLGNH-------------LSDRSNNDDSDGSLPCTPQ-------------
A0A8C7H1W6_MCL1-01      VLDNH-------------LSDRSNNDD---SLPCTPQ-------------
A0A8C7H1W6_MCL1-02      VLDNH-------------LSDRSNNDD---SLPCTPQ-------------
                        :*.:*             *:** .* :    *    :             

A0A8C7N2B4_MCL1-01      ITNSTGA-----------LDTDTRQLIKCVLGQCTGLLKPRWNESKALST
A0A8C7H400_MCL1-01      MASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLS--RCKQSKALTT
A0A8C7H400_MCL1-02      MASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLS--RCKQSKALTT
A0A8C7H1W6_MCL1-01      MASECGPEL---------LEHDTRQLIDDMLREYTGLSQPRWKQSKYLTT
A0A8C7H1W6_MCL1-02      MASECGPEL---------LEHDTRQLIDDMLREYTGLSQPRWKQSKYLTT
                        ::.. *.           *: ******. :* : ***   * ::** *:*

A0A8C7N2B4_MCL1-01      MSRVIGQLLEKHRYTYNGMINTLYVDDRGDNVKFLSAVAHSIFEDGTVNW
A0A8C7H400_MCL1-01      MKRVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDGTTNW
A0A8C7H400_MCL1-02      MKRVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDGTTNW
A0A8C7H1W6_MCL1-01      MKRVVEDVIAKHRYAYNGMVVKLDLDDRCDDMSVVNSVAKTMFSDGITNW
A0A8C7H1W6_MCL1-02      MKRVVEDVIAKHRYAYNGMVVKLDLDDRCDDMSVVNSVAKTMFSDGITNW
                        *.**: ::: ****:****: .* :*** *::..:.:**:::*.** .**

A0A8C7N2B4_MCL1-01      GRVASLTSFGAAVCRYLRGKGRDNCVDLVGEEISEYLVTHHKDWLVKHNS
A0A8C7H400_MCL1-01      GRIASLVAFGAVVSQHLKEIGRGHCIESVGQKIATYLLSDQRDWLVKNNA
A0A8C7H400_MCL1-02      GRIASLVAFGAVVSQHLKEIGRGHCIESVGQKIATYLLSDQRDWLVKNNA
A0A8C7H1W6_MCL1-01      GRIASLVAFGAVVSQHLKESGRGHCVDLVGREIATYLLSDQRDWLVKNNA
A0A8C7H1W6_MCL1-02      GRIASLVAFGAVVSQHLKESGRGHCVDLVGREIATYLLSDQRDWLVKNNA
                        **:***.:***.*..:*.  **.:*:: ** :*: **:: :.*****:*:

A0A8C7N2B4_MCL1-01      WNGFVEFFPVAEPESRCRNIIMTIFGLAGIGATMTFLVM-----------
A0A8C7H400_MCL1-01      WNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLIRQCPALPQGCVV
A0A8C7H400_MCL1-02      WNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLIRNSAD-------
A0A8C7H1W6_MCL1-01      WNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMLIRKCPALPQGCVV
A0A8C7H1W6_MCL1-02      WNGFVEFFHVQDPESSKMDYARKFSEI--LDSTMVGMSTQ----------
                        ******** * :***   :    :  .  :.:*:. :             

A0A8C7N2B4_MCL1-01      --
A0A8C7H400_MCL1-01      CL
A0A8C7H400_MCL1-02      --
A0A8C7H1W6_MCL1-01      CL
A0A8C7H1W6_MCL1-02      --
                          

© 1998-2022Legal notice