Dataset for protein Bcl-2 of organism Oncorhynchus kisutch

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C7CHJ0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL-2 (length=230 residues).
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFYPENDSPNNGFGEPSPPNSPEVFARRSQPSAEGVDTDSPLQNRIPQPDR
HARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRFTAVIEELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQRISAFHSWPYLKTVFGLAALGAAGVTIGALFIQK
>gnl|bcl2dbpro|A0A8C7G8X1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL-2 (length=226 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRPGLARRCHGANNGGPGSVPSLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLNWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A8C7N3I9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL-2 (length=224 residues).
MANDDNRCIVEKYICHKLLKRGYAWDFENAEEDADNNGSMISPPPGLARRCHGANNARPGSVPHLSKRLSQTDPHAAIHR
VLREAGDELERLYQPDFAEMSHQLYLTSSMAERRFREVIDELFRDGVNWGRIVAFFEFGGTICVECVNKEMTSQVDHIAG
WMTEYLNGPLHNWIQENGGWEAFVELYDRQRDSVFGSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2022Legal notice