Dataset for protein Bcl-2 of organism Oncorhynchus kisutch

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7CHJ0_BCL2-01      MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFYPEND---SPNNGFGEPSP
A0A8C7G8X1_BCL2-01      MANDDN----RFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPR
A0A8C7N3I9_BCL2-01      MANDDN----RCIVEKYICHKLLKRGYAWDFENAEED--ADNNGSMISPP
                        *  :**    * ****** *****.*:.*:*   ::   : ***   .. 

A0A8C7CHJ0_BCL2-01      PNSPEVFARRSQPSAEGVDTDSP-LQNRIPQPDRHARLHRVLREAGDEIE
A0A8C7G8X1_BCL2-01      PG----LARRCHGANNGGPGSVPSLSKWLSQPDPHAAIHRVLREAGDELE
A0A8C7N3I9_BCL2-01      PG----LARRCHGANNARPGSVPHLSKRLSQTDPHAAIHRVLREAGDELE
                        *.    :***.: : :.   . * *.:.:.*.* ** :**********:*

A0A8C7CHJ0_BCL2-01      IMYQRDFAEMSGQLHFTPSTAQRRFTAVIEELFSDGVNWGRIVAFFEFGG
A0A8C7G8X1_BCL2-01      RLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGG
A0A8C7N3I9_BCL2-01      RLYQPDFAEMSHQLYLTSSMAERRFREVIDELFRDGVNWGRIVAFFEFGG
                         :** ****** **::*.* *:***  **:*** ********:*******

A0A8C7CHJ0_BCL2-01      TMCVESVNREMTSQVDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQ
A0A8C7G8X1_BCL2-01      TICVECVNKEMTSQVDHIAVWMTEYLNGPLLNWIQENGGWEAFVELYDRQ
A0A8C7N3I9_BCL2-01      TICVECVNKEMTSQVDHIAGWMTEYLNGPLHNWIQENGGWEAFVELYDRQ
                        *:***.**.*******:** ********** *******.*:****:*..*

A0A8C7CHJ0_BCL2-01      RISAFHSWPYLKTVFGLAALGAAGVTIGALFIQK
A0A8C7G8X1_BCL2-01      RDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
A0A8C7N3I9_BCL2-01      RDSVFGSWPSIKTVFGLAALGAASLTIGAYLTQK
                        * *.* *** :************.:**** : **

© 1998-2022Legal notice