Dataset for protein BCL-2-like of organism Nothoprocta perdicaria

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C6YT47_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nothoprocta perdicaria GN=MCL-1 (length=234 residues).
MGVTVVTGILGSARGAVDVSGRGQSETDIGGPQQCYRAQRRRGRVQAWRCYRGHAYKDQHGGGEGAGSGPAKLFSGLLSG
PGRPGGAGLMEKALETLRRVGDGVMRKHELAFQGMLRKLEIQKEEDLQSVSEVAVHVFSDGVTNWGRVVTLISFGAFVAK
HLKSINQEKCIPSLAGIITDALISSKREWLLSQGGWEGFVDFFQVEDLERSIRNVLVAFAGFAGLGASLAYMIR
>gnl|bcl2dbpro|A0A8C6ZF48_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Nothoprocta perdicaria GN=BCL-2 (length=240 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASGDRAPASPALSPPAAAAAAAAPAAAGTPSDHTGPVSRHPEPPGSAAA
SNEGEGLRPAPPGVHLALRQAGDEFSRRYQRDFAHMSGQLHLTPVTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCV
ESVNREMSPLVDSIAAWMTEYLNRHLQNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYFGHK
>gnl|bcl2dbpro|A0A8C6ZVQ3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Nothoprocta perdicaria GN=BCL2A1 (length=174 residues).
METAEFYYVYYLTHDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPILDRIDIDSVDVAKRIFNGVMEENFA
DGNTNWGRITTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLSKFERRSLLSLSKIT
ALLMAFFSLFREYY
>gnl|bcl2dbpro|A0A8C7ECQ9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Nothoprocta perdicaria GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLQEEDENRTDFAVDPEVDGVLNGSPSWHPPGSHIVNGAAVHRSSPEVREIVHAA
DVRQALKEAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVAWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQESFNKWLLTGATVAGVLLLGSLLSRK
© 1998-2022Legal notice