Dataset for protein BCL-2-like of organism Nothoprocta perdicaria

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6ZVQ3_BCL2A1-      --------------METAEFYYVYYLTHD---------------------
A0A8C7ECQ9_BCL2L1-      ---------MSSSNRELVIDFVSYKLSQKGYSWSQLQEEDENR-------
A0A8C6YT47_MCL1-01      MGVTVVTGILGSARGAV-------DVSGRGQSETDIGGPQQCYRAQRRRG
A0A8C6ZF48_BCL2-01      ---MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASGDRAPASPALSPPA
                                                 ::                       

A0A8C6ZVQ3_BCL2A1-      -------YLQYVLQESHLGPAQTRVA------------------------
A0A8C7ECQ9_BCL2L1-      --------TDFAVDPEVDGVLNGSPSWHPPGSHIVNGAAVHRSSPEVREI
A0A8C6YT47_MCL1-01      RVQAWRCYRGHAYKDQHGGGEGAGSGPAKLFSGLLSGPG-RPGGAGLMEK
A0A8C6ZF48_BCL2-01      AAAAAAAPAAAGTPSDHTGPVSRHPEPPGSAAASNEGEGLRPAPPGV---
                                       .  *                               

A0A8C6ZVQ3_BCL2A1-      -------HVLRNIASSLQDQTEEALRPILDRIDIDSVDVAKRIFNGVMEE
A0A8C7ECQ9_BCL2L1-      VHAADVRQALKEAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQVVNE
A0A8C6YT47_MCL1-01      AL-----ETLRRVGDGVMRKHELAFQGMLRKLEIQKEEDLQS-VSEVAVH
A0A8C6ZF48_BCL2-01      -H-----LALRQAGDEFSRRYQRDFAHMSGQLHLTPVTARGR-FVAVVEE
                                .*.  .. .  .    :  :  .: :         .  *   

A0A8C6ZVQ3_BCL2A1-      NFADGNTNWGRITTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYII
A0A8C7ECQ9_BCL2L1-      LFRDGV-NWGRIVAFFSFGGALCVESVDKEMRVL---VGRIVAWMTTYLT
A0A8C6YT47_MCL1-01      VFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKC---IPSLAGIITDALI
A0A8C6ZF48_BCL2-01      LFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPL---VDSIAAWMTEYLN
                         * **  ****:.::: **. :     .            :   :*  : 

A0A8C6ZVQ3_BCL2A1-      NNKAEWIDANGGWENGFLSKFERRS--------------LLSLSKITALL
A0A8C7ECQ9_BCL2L1-      DHLDPWIQENGGWE-RFVDLYGNDAAAEMRKGQESFNKWLLTGATVAGVL
A0A8C6YT47_MCL1-01      SSKREWLLSQGGWE-GFVD--------FFQVEDLERSI-RNVLVAFAGFA
A0A8C6ZF48_BCL2-01      RHLQNWIQDNGGWD-AFVELYGNSMRPLFDFSWISLKT-ILSLVLVGACI
                             *:  :***:  *:.                          . .  

A0A8C6ZVQ3_BCL2A1-      MAFFSLFREYY
A0A8C7ECQ9_BCL2L1-      LLGSLLSRK--
A0A8C6YT47_MCL1-01      GLGASLAYMIR
A0A8C6ZF48_BCL2-01      TLGAYFGHK--
                             :     

© 1998-2022Legal notice