Dataset for protein BCL-2-like of organism Nothobranchius furzeri

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A1A7ZDF6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Nothobranchius furzeri GN=BCL2L1 (length=233 residues).
MSQNQELVLFYIRYKLSQRNYPLNHIVLNDPLNRTGAGDAVVGGEEERTETHANGTFNRTSPGTPAASPLRQQPPASTTD
MDRVKEALRDTANEFELRYARAFNDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VVRIVEWMTVYLDNHIQPWIQSQGGWERFADIFGHDAAAESRRFQESFRMWLLVGMTVLTAVVAGSLFAQKRL
>gnl|bcl2dbpro|A0A1A8A2S0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Nothobranchius furzeri GN=BCL2L1 (length=219 residues).
MPHSNRELVEYYISYKLSQRNCPMSLLGPEDGGKKTREDWDNSAASNGRLVSSRDSPPGKTCAPRGGMEAVKSALKDSAD
EFELLYAQSFSHLSLQLDITPDTAYHSFKSVLDELFRDGVNWGRVVGLFVFGGLLCVQCKERNLSELVPRIADWMTTYLD
DQIGLWISSQGGWDCFAEIYGRGAAAEARRFQETLKKWLLAGVLLLSGVLLGVLIAKKR
>gnl|bcl2dbpro|A0A1A8A7I9_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nothobranchius furzeri GN=MCL-1 (length=273 residues).
MLQRKTPSSVFGCLFSQNGVVDGPLHYGPGDSPPHIATGATLDSANGNVESGDGPKRPSNLEVSPHNGFAAKRFSHEEED
GSLPCTPEFHAGSETEVPSGHAGDEALANDTRQLINRFFMEFTGQLKPQWRDSRELSTMKRVVNDILEKHRYAYKGMAAK
CTSDDLTFISKVAENMFSDGITNWGRIVSLLAFGAVVAQYQKDNGRQNNVELVSHEVSTYLLSQQRDFLLRNNSWQGFVE
FFRVTDPESTVRNTLMAIAGVAGMGATLALLIR
>gnl|bcl2dbpro|A0A1A8A7I9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nothobranchius furzeri GN=MCL-1 (length=290 residues).
MLQRKTPSSVFGCLFSQNGVVDGPLHYGPGDSPPHIATGATLDSANGNVESGDGPKRPSNLEVSPHNGFAAKRFSHEEED
GSLPCTPEFHAGSETEVPSGHAGDEALANDTRQLINRFFMEFTGQLKPQWRDSRELSTMKRVVNDILEKHRYAYKGMAAK
CTSDDLTFISKVAENMFSDGITNWGRIVSLLAFGAVVAQYQKDNGRQNNVELVSHEVSTYLLSQQRDFLLRNNSWQGFVE
FFRVTDPESTVRNTLMAIAGVAGMGATLALLISCCRHDTSFQTVPSIPSY
>gnl|bcl2dbpro|A0A1A8A7I9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nothobranchius furzeri GN=MCL-1 (length=273 residues).
MLQRKTPSSVFGCLFSQNGVVDGPLHYGPGDSPPHIATGATLDSANGNVESGDGPKRPSNLEVSPHNGFAAKRFSHEEED
GSLPCTPEFHAGSETEVPSGHAGDEALANDTRQLINRFFMEFTGQLKPQWRDSRELSTMKRVVNDILEKHRYAYKGMAAK
CTSDDLTFISKVAENMFSDGITNWGRIVSLLAFGAVVAQYQKDNGRQNNVELVSHEVSTYLLSQQRDFLLRNNSWQGFVE
FFRVTDPESTVRNTLMAIAGVAGMGATLALLIR
>gnl|bcl2dbpro|A0A1A8VCB0_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Nothobranchius furzeri GN=BCL2L10 (length=204 residues).
MWRELSPTAGRKMSCGLWNDTLAVAEDYLSTCCCGPNPAPPPPSETAAAMRRLAQDMETQHQTRFHSLAQNFLKRCGPDI
CSSLRKVMDEMAGDGHFNWGRVVSLFAFTGVLIRQLQEQRTSRPGLDPGQELEPKLISCRLLAETIADYLVKHKKGWLLE
NEGWEGFSQYSHNTRPVSLDSSMKTALVAVAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A1A8VCB0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Nothobranchius furzeri GN=BCL2L10 (length=255 residues).
MGGGLNAQKGSGDCPEVLLPPSGCGESCHLPLGGEHGTSDRASMSTSGPWVPTRGVASLSYSKMSCGLWNDTLAVAEDYL
STCCCGPNPAPPPPSETAAAMRRLAQDMETQHQTRFHSLAQNFLKRCGPDICSSLRKVMDEMAGDGHFNWGRVVSLFAFT
GVLIRQLQEQRTSRPGLDPGQELEPKLISCRLLAETIADYLVKHKKGWLLENEGWEGFSQYSHNTRPVSLDSSMKTALVA
VAGVGLAGLTFLLVR
© 1998-2021Legal notice