Dataset for protein BCL-2-like of organism Nothobranchius furzeri

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1A8A7I9_MCL1-02      MLQRKTPSSVFGCLFSQNGVVDGPLHYGPGDSPPHIATGATLDSANGNVE
A0A1A8A7I9_MCL1-03      MLQRKTPSSVFGCLFSQNGVVDGPLHYGPGDSPPHIATGATLDSANGNVE
A0A1A8A7I9_MCL1-01      MLQRKTPSSVFGCLFSQNGVVDGPLHYGPGDSPPHIATGATLDSANGNVE
A0A1A7ZDF6_BCL2L1-      -MSQNQELVLFYIRYKLS---------QRNYPLNHIVLNDPLNRTGAGDA
A0A1A8VCB0_BCL2L10      -MGGGLN----------A---------QKGSGDCPEVLLPPSGCGESCHL
A0A1A8A2S0_BCL2L1-      MPHSNRELVEYYISYKLS---------QRNCPM-----------------
A0A1A8VCB0_BCL2L10      -------------------------------MW-----------------
                                                                          

A0A1A8A7I9_MCL1-02      SGDGPKRPSNLEVSPHNG----------FAAKRFSHEEEDGSLPCTPEFH
A0A1A8A7I9_MCL1-03      SGDGPKRPSNLEVSPHNG----------FAAKRFSHEEEDGSLPCTPEFH
A0A1A8A7I9_MCL1-01      SGDGPKRPSNLEVSPHNG----------FAAKRFSHEEEDGSLPCTPEFH
A0A1A7ZDF6_BCL2L1-      VVGGE---EERTETHANG-----------TFNRTSPG-------------
A0A1A8VCB0_BCL2L10      PLGGEHGTSDRASMSTSGPWVPTRGVASLSYSKMSCGLWNDTLAVAEDYL
A0A1A8A2S0_BCL2L1-      ----------SLLGPEDG-------------GKKTREDWDNSAASNGRLV
A0A1A8VCB0_BCL2L10      ----------RELSPTAG-------------RKMSCGLWNDTLAVAEDYL
                                         *              . :               

A0A1A8A7I9_MCL1-02      AGSETEVPSGHAGDEALANDTRQLINRFFMEFTGQLKPQWRDSRELSTMK
A0A1A8A7I9_MCL1-03      AGSETEVPSGHAGDEALANDTRQLINRFFMEFTGQLKPQWRDSRELSTMK
A0A1A8A7I9_MCL1-01      AGSETEVPSGHAGDEALANDTRQLINRFFMEFTGQLKPQWRDSRELSTMK
A0A1A7ZDF6_BCL2L1-      -TPAASPLRQQPPASTTDMDRVK-----------------------EALR
A0A1A8VCB0_BCL2L10      STCCCGPNPAPPPPSETA----------------------------AAMR
A0A1A8A2S0_BCL2L1-      SSRDSPPGKTCAPRGGME--AVK-----------------------SALK
A0A1A8VCB0_BCL2L10      STCCCGPNPAPPPPSETA--A--------------------------AMR
                                   .                                   ::.

A0A1A8A7I9_MCL1-02      RVVNDILEKHRYAYKGMAAK----CTSDDLTFISKVAENMFSDGITNWGR
A0A1A8A7I9_MCL1-03      RVVNDILEKHRYAYKGMAAK----CTSDDLTFISKVAENMFSDGITNWGR
A0A1A8A7I9_MCL1-01      RVVNDILEKHRYAYKGMAAK----CTSDDLTFISKVAENMFSDGITNWGR
A0A1A7ZDF6_BCL2L1-      DTANEFELRYARAFNDL-HSQLHITPATAYQSFENVMDEVFRDG-VNWGR
A0A1A8VCB0_BCL2L10      RLAQDMETQHQTRFHSLAQNFLKRCGPDICSSLRKVMDEMAGDGHFNWGR
A0A1A8A2S0_BCL2L1-      DSADEFELLYAQSFSHLSLQ-LDITPDTAYHSFKSVLDELFRDG-VNWGR
A0A1A8VCB0_BCL2L10      RLAQDMETQHQTRFHSLAQNFLKRCGPDICSSLRKVMDEMAGDGHFNWGR
                          .:::   :   :  :  .            : .* :::  **  ****

A0A1A8A7I9_MCL1-02      IVSLLAFGAVVAQYQKD--------------NGRQNNVELVSHEVSTYLL
A0A1A8A7I9_MCL1-03      IVSLLAFGAVVAQYQKD--------------NGRQNNVELVSHEVSTYLL
A0A1A8A7I9_MCL1-01      IVSLLAFGAVVAQYQKD--------------NGRQNNVELVSHEVSTYLL
A0A1A7ZDF6_BCL2L1-      IVGLFAFGGALCVECVE-----------KEMSPLVVR---IVEWMTVYLD
A0A1A8VCB0_BCL2L10      VVSLFAFTGVLIRQLQEQRTSRPGLDPGQELEPKLISCRLLAETIADYLV
A0A1A8A2S0_BCL2L1-      VVGLFVFGGLLCVQCKERNLS--------ELVPR------IADWMTTYLD
A0A1A8VCB0_BCL2L10      VVSLFAFTGVLIRQLQEQRTSRPGLDPGQELEPKLISCRLLAETIADYLV
                        :*.*:.* . :     :                       :   :: ** 

A0A1A8A7I9_MCL1-02      SQQRDFLLRNNSWQGFVEFFRVTDPESTVR----------NTLMAIAGVA
A0A1A8A7I9_MCL1-03      SQQRDFLLRNNSWQGFVEFFRVTDPESTVR----------NTLMAIAGVA
A0A1A8A7I9_MCL1-01      SQQRDFLLRNNSWQGFVEFFRVTDPESTVR----------NTLMAIAGVA
A0A1A7ZDF6_BCL2L1-      NHIQPWIQSQGGWERFADIFGHDAAAESRRFQESFRMWLLVGMTVLTAV-
A0A1A8VCB0_BCL2L10      KHKKGWLLENEGWEGFSQ-YSHNTRPVSLDSSMKTALVAVAGVG------
A0A1A8A2S0_BCL2L1-      DQIGLWISSQGGWDCFAEIYGRGAAAEARRFQETLKKWLLAGVLLLSGV-
A0A1A8VCB0_BCL2L10      KHKKGWLLENEGWEGFSQYSHNTRPV-------SLDSSMKTALVAVAGVG
                        .:   ::  : .*: * :                        :       

A0A1A8A7I9_MCL1-02      GMGATLALLISCCRHDTSFQTVPSIPSY
A0A1A8A7I9_MCL1-03      GMGATLALLIR-----------------
A0A1A8A7I9_MCL1-01      GMGATLALLIR-----------------
A0A1A7ZDF6_BCL2L1-      VAGSLFAQKRL-----------------
A0A1A8VCB0_BCL2L10      LAGLTFLLVR------------------
A0A1A8A2S0_BCL2L1-      LLGVLIAKKR------------------
A0A1A8VCB0_BCL2L10      LAGLTFLLVR------------------
                          *  :                      

© 1998-2021Legal notice