Dataset for protein Bcl-xL of organism Nothobranchius furzeri

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A1A7ZDF6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Nothobranchius furzeri GN=BCL2L1 (length=233 residues).
MSQNQELVLFYIRYKLSQRNYPLNHIVLNDPLNRTGAGDAVVGGEEERTETHANGTFNRTSPGTPAASPLRQQPPASTTD
MDRVKEALRDTANEFELRYARAFNDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPL
VVRIVEWMTVYLDNHIQPWIQSQGGWERFADIFGHDAAAESRRFQESFRMWLLVGMTVLTAVVAGSLFAQKRL
>gnl|bcl2dbpro|A0A1A8A2S0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Nothobranchius furzeri GN=BCL2L1 (length=219 residues).
MPHSNRELVEYYISYKLSQRNCPMSLLGPEDGGKKTREDWDNSAASNGRLVSSRDSPPGKTCAPRGGMEAVKSALKDSAD
EFELLYAQSFSHLSLQLDITPDTAYHSFKSVLDELFRDGVNWGRVVGLFVFGGLLCVQCKERNLSELVPRIADWMTTYLD
DQIGLWISSQGGWDCFAEIYGRGAAAEARRFQETLKKWLLAGVLLLSGVLLGVLIAKKR
© 1998-2021Legal notice