Dataset for protein Bcl-xL of organism Nothobranchius furzeri

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1A7ZDF6_BCL2L1-      -MSQNQELVLFYIRYKLSQRNYPLNHIVLNDPLNRTGAGDAVVGGEEERT
A0A1A8A2S0_BCL2L1-      MPHSNRELVEYYISYKLSQRNCPMSLLGPED------------GGKKTRE
                           .*.*** :** ******* *:. :  :*            **:: * 

A0A1A7ZDF6_BCL2L1-      ETHANGTFNRTSPGTPAASPLRQQPPASTT----DMDRVKEALRDTANEF
A0A1A8A2S0_BCL2L1-      D------WDNSAASNGRLVSSRDSPPGKTCAPRGGMEAVKSALKDSADEF
                        :      ::.::...    . *:.**..*     .*: **.**.*:*:**

A0A1A7ZDF6_BCL2L1-      ELRYARAFNDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFG
A0A1A8A2S0_BCL2L1-      ELLYAQSFSHLSLQLDITPDTAYHSFKSVLDELFRDGVNWGRVVGLFVFG
                        ** **.:*. *  ** *** ***:**:.*:**:*********:****.**

A0A1A7ZDF6_BCL2L1-      GALCVECVEKEMSPLVVRIVEWMTVYLDNHIQPWIQSQGGWERFADIFGH
A0A1A8A2S0_BCL2L1-      GLLCVQCKERNLSELVPRIADWMTTYLDDQIGLWISSQGGWDCFAEIYGR
                        * ***:* *.::* ** **.:***.***::*  **.*****: **:*:*.

A0A1A7ZDF6_BCL2L1-      DAAAESRRFQESFRMWLLVGMTVLTAVVAGSLFAQKRL
A0A1A8A2S0_BCL2L1-      GAAAEARRFQETLKKWLLAGVLLLSGVLLGVLIAKKR-
                        .****:*****::. ***.*: :*:.*: * *:*:** 

© 1998-2021Legal notice