Dataset for protein BCL-2-like of organism Neogobius melanostomus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C6SVR4_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neogobius melanostomus GN=MCL-1 (length=273 residues).
MLPAKRTKFGIPTTMLGMLMPQNGVVEAEGAMTMDARNGNGSLSHCHPQQQRPTALQVKNDHSRKHKNLREGDYDHNSDG
GSLPCTPEFQSDSEQEMSGYSVENDTRQLLGDFFELITGISQPGWLQRPALTTMKRVVDNLLEKHRIAYNGRYDKQTVSG
RQGDDVTFMGDVARSIFEDGTTNWGRIASLISFGAVVCQYLKSKGRESCVERVAEEISSYLLSDQRDWLIRNNSWDGFVE
FFRVDDPESKVRNTLMAVAGLAGIGATLAMLIR
>gnl|bcl2dbpro|A0A8C6SVR4_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neogobius melanostomus GN=MCL-1 (length=272 residues).
MLPAKRTKFGIPTTMLGMLMPQNGVVEAEGAMTMDARNGNGSLSHCHPQQQRPTALQVKNDHSRKHKNLREGDYDHNSDG
GSLPCTPEFQSDSEQEMSGYSVENDTRQLLGDFFELITGISQPGWLQRPALTTMKRVVDNLLEKHRIAYNGRLNLPSNPN
WGDDVTFMGDVARSIFEDGTTNWGRIASLISFGAVVCQYLKSKGRESCVERVAEEISSYLLSDQRDWLIRNNSWDGFVEF
FRVDDPESKVRNTLMAVAGLAGIGATLAMLIR
>gnl|bcl2dbpro|A0A8C6SVR4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neogobius melanostomus GN=MCL-1 (length=246 residues).
VCYLQNGQNSASLQQCWVCLCLKMESPTALQVKNDHSRKHKNLREGDYDHNSDGGSLPCTPEFQSDSEQEMSGYSVENDT
RQLLGDFFELITGISQPGWLQRPALTTMKRVVDNLLEKHRIAYNGRLNLPSNPNWGDDVTFMGDVARSIFEDGTTNWGRI
ASLISFGAVVCQYLKSKGRESCVERVAEEISSYLLSDQRDWLIRNNSWDGFVEFFRVDDPESKVRNTLMAVAGLAGIGAT
LAMLIR
>gnl|bcl2dbpro|A0A8C6UPI9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Neogobius melanostomus GN=BCL2L1 (length=206 residues).
IMSHSNRELVEFFLSYKLTQKNYPCSLLMSDSARVQSDGNKAACVLNGLLSNPNGSRRTLSSQSHDHIEDVKTALRDSAD
EFEELFTQAFSNLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRICVEKDMSNLVPRIADWMTIYLDENIASWIQSQGGW
DCFAQIFGQNAAAEARRSRETLKKWLLVGVGLLTGVLVAMLIARKQ
>gnl|bcl2dbpro|A0A8C6UWE4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Neogobius melanostomus GN=BCL2L10 (length=187 residues).
MSCGLWKETLALAEDYLCLCCSPQAARPPPSGSAAAMRRLGQDMEAQHKARFHTLSQTFLKQCGPDPCSSLRKVMEELVG
DGLLNWGRVVSLFTFAGVLARQIQEQKCSRSGQDPGKVPADCRLLAETIADYLGEEKRDWLLDNGGWVGFCEFSCHSRKV
DQDSSMKTALFAAAGVGLAGLTFLLVR
© 1998-2022Legal notice