Dataset for protein BCL-2-like of organism Neogobius melanostomus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6SVR4_MCL1-02      MLPAKRTKFGIPTTMLGMLMPQNGVVEAEGAMTMDARNGNGSLSHCHP--
A0A8C6SVR4_MCL1-03      MLPAKRTKFGIPTTMLGMLMPQNGVVEAEGAMTMDARNGNGSLSHCHP--
A0A8C6SVR4_MCL1-01      ------------------------------VCYLQNGQNSASLQQCWVCL
A0A8C6UPI9_BCL2L1-      ------------------------------IMSHSNRELVEFFLSYKL--
A0A8C6UWE4_BCL2L10      -------------------------------------MSCGLWKETLA--
                                                                          

A0A8C6SVR4_MCL1-02      --QQQRPTALQVKNDHSRKHKNLREGDYDHNSDGGSLPCTPEFQSDSEQE
A0A8C6SVR4_MCL1-03      --QQQRPTALQVKNDHSRKHKNLREGDYDHNSDGGSLPCTPEFQSDSEQE
A0A8C6SVR4_MCL1-01      CLKMESPTALQVKNDHSRKHKNLREGDYDHNSDGGSLPCTPEFQSDSEQE
A0A8C6UPI9_BCL2L1-      --------------------------------TQKNYPCSLLMSDSARVQ
A0A8C6UWE4_BCL2L10      --------------------------------LAEDYLCLCCSPQAARPP
                                                           .  *     . :   

A0A8C6SVR4_MCL1-02      MSGYSVENDTRQLLGDFFELITGISQPGWLQRPALT-TMKRVVDNLLEKH
A0A8C6SVR4_MCL1-03      MSGYSVENDTRQLLGDFFELITGISQPGWLQRPALT-TMKRVVDNLLEKH
A0A8C6SVR4_MCL1-01      MSGYSVENDTRQLLGDFFELITGISQPGWLQRPALT-TMKRVVDNLLEKH
A0A8C6UPI9_BCL2L1-      SDGNKAACVLNGLLSNPNGSRRTLSSQSHDHIEDVKTALRDSADEFEELF
A0A8C6UWE4_BCL2L10      PSGSAA-------------------------------AMRRLGQDMEAQH
                         .*  .                               ::.   :::   .

A0A8C6SVR4_MCL1-02      RIAYNGRYDKQTVSGRQGDDVTFMGDVARSIFEDGTTNWGRIASLISFGA
A0A8C6SVR4_MCL1-03      RIAYNGRLNLPSNPNW-GDDVTFMGDVARSIFEDGTTNWGRIASLISFGA
A0A8C6SVR4_MCL1-01      RIAYNGRLNLPSNPNW-GDDVTFMGDVARSIFEDGTTNWGRIASLISFGA
A0A8C6UPI9_BCL2L1-      TQAFSNLSSQL--DITPDTAYHSFKSVMDEVFKDG-VNWGRICVEKDMSN
A0A8C6UWE4_BCL2L10      KARFHTLSQTFLKQCGPDPC-SSLRKVMEELVGDGLLNWGRVVSLFTFAG
                           :    .        .     : .*  .:. **  ****:     :. 

A0A8C6SVR4_MCL1-02      VVCQYLKSKGRESCVER----------VAEEISSYLLSDQRDWLIRNNSW
A0A8C6SVR4_MCL1-03      VVCQYLKSKGRESCVER----------VAEEISSYLLSDQRDWLIRNNSW
A0A8C6SVR4_MCL1-01      VVCQYLKSKGRESCVER----------VAEEISSYLLSDQRDWLIRNNSW
A0A8C6UPI9_BCL2L1-      LVPR-----------------------IADWMTIYLDENIASWIQSQGGW
A0A8C6UWE4_BCL2L10      VLARQIQEQKCSRSGQDPGKVPADCRLLAETIADYLGEEKRDWLLDNGGW
                        :: .                       :*: :: ** .:  .*:  :..*

A0A8C6SVR4_MCL1-02      DGFVEFFRVDD------PESKVRNTLMAVAGLAGIGATLAMLIR---
A0A8C6SVR4_MCL1-03      DGFVEFFRVDD------PESKVRNTLMAVAGLAGIGATLAMLIR---
A0A8C6SVR4_MCL1-01      DGFVEFFRVDD------PESKVRNTLMAVAGLAGIGATLAMLIR---
A0A8C6UPI9_BCL2L1-      DCFAQIFGQNAAAEARRSRETLKKWLLVGVGL-LTGVLVAMLIARKQ
A0A8C6UWE4_BCL2L10      VGFCEFSCHSRKVD---QDSSMKTALFAAAGV-GLAGLTFLLVR---
                          * ::   .         ..:.. *:. .*:   .    :*:    

© 1998-2022Legal notice