Dataset for protein Bfl1 of organism Nannospalax galili

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C6QF32_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Nannospalax galili GN=BCL2A1 (length=175 residues).
MTDCEFTSVYSLAEDYLQYVLQVPLFESAPSKTSRVLQKVAFSVQKEVEKNLKPYLDNFDVVSIDTARTIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQMDLDVDTYKQVSYFVAEFIMNNTGEWIRQNGGWEDGFIRKFEPKSGWLTFLEV
MGQIWELIFLLKHHH
>gnl|bcl2dbpro|A0A8C6R201_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Nannospalax galili GN=BCL2A1 (length=154 residues).
YSLAEDYLQYVLQVPSFESAPIVFSVQKEVEQNLKLYLDNFDVVPTDTASTIFNQVMEKEFEDGIINWGRIVTIFAFGGV
FLKELPQEQMDLDVDTYKQVSCFVAEFIKNNTGEWIRQNGGWVYGFIRKFEPKSGWLTFLEVMGQIWELIFLLK
© 1998-2022Legal notice