Dataset for protein Bfl1 of organism Nannospalax galili

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6QF32_BCL2A1-      MTDCEFTSVYSLAEDYLQYVLQVPLFESAPSKTSRVLQKVAFSVQKEVEK
A0A8C6R201_BCL2A1-      ---------YSLAEDYLQYVLQVPSFESAP---------IVFSVQKEVEQ
                                 *************** *****         :.********:

A0A8C6QF32_BCL2A1-      NLKPYLDNFDVVSIDTARTIFNQVMEKEFEDGIINWGRIVTIFAFGGVLL
A0A8C6R201_BCL2A1-      NLKLYLDNFDVVPTDTASTIFNQVMEKEFEDGIINWGRIVTIFAFGGVFL
                        *** ********. *** ******************************:*

A0A8C6QF32_BCL2A1-      KKLPQEQMDLDVDTYKQVSYFVAEFIMNNTGEWIRQNGGWEDGFIRKFEP
A0A8C6R201_BCL2A1-      KELPQEQMDLDVDTYKQVSCFVAEFIKNNTGEWIRQNGGWVYGFIRKFEP
                        *:***************** ****** *************  ********

A0A8C6QF32_BCL2A1-      KSGWLTFLEVMGQIWELIFLLKHHH
A0A8C6R201_BCL2A1-      KSGWLTFLEVMGQIWELIFLLK---
                        **********************   

© 1998-2022Legal notice