Dataset for protein Bcl-xL of organism Myripristis murdjan

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A667Y1V0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Myripristis murdjan GN=BCL2L1 (length=222 residues).
MSYSNRELVVFFINYKLSQRNYPTCQLGLEEASERTEGDDADAVISNGSLANSRTGAGQPGTPSPPYGGIEVVKAALQES
ADEFELRYTQAFSSLSSQLHITPATAYHSFESVMDEVFRNGVNWGRVVGLFAFGGALCVECVERDMNQLVPRIADWMTTY
LDNHIEPWIQREGGWDRFAEIYGRDAAAEARRAQESLRRWLLVGVVLLTGVLLGALIAKKHP
>gnl|bcl2dbpro|A0A667ZHE8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Myripristis murdjan GN=BCL2L1 (length=232 residues).
MSQNRELVVFYITYKLSQRNYPFNHIGLIESPNRTDGGQAGAAEEQRVATHANGTLNGTSPGTPPASPLRRERSASTTSL
DAVKEALRDSANEFELRYARAFNDLHDQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLV
SRIAEWMTVYLDNHIQPWIHSQGGWERFAEIYGQDAAAEGRRAQESFRKWLLAGMTLVTGVVVGSLIAQKRL
© 1998-2020Legal notice