Dataset for protein Bcl-xL of organism Myripristis murdjan

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A667Y1V0_BCL2L1-      MSYSNRELVVFFINYKLSQRNYPTCQLGLEEASERTEGDDADAVISN--G
A0A667ZHE8_BCL2L1-      -MSQNRELVVFYITYKLSQRNYPFNHIGLIESPNRTDGGQAGAAEEQRVA
                           .*******:*.*********  ::** *:.:**:*.:*.*. .:  .

A0A667Y1V0_BCL2L1-      SLANSRTGAGQPGTP---------SPPYGGIEVVKAALQESADEFELRYT
A0A667ZHE8_BCL2L1-      THANGTLNGTSPGTPPASPLRRERSASTTSLDAVKEALRDSANEFELRYA
                        : **.  .. .****         *..  .::.** **.:**:******:

A0A667Y1V0_BCL2L1-      QAFSSLSSQLHITPATAYHSFESVMDEVFRNGVNWGRVVGLFAFGGALCV
A0A667ZHE8_BCL2L1-      RAFNDLHDQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALCV
                        .**..* .**********:***********:*******************

A0A667Y1V0_BCL2L1-      ECVERDMNQLVPRIADWMTTYLDNHIEPWIQREGGWDRFAEIYGRDAAAE
A0A667ZHE8_BCL2L1-      ECVEKEMSPLVSRIAEWMTVYLDNHIQPWIHSQGGWERFAEIYGQDAAAE
                        ****.:*. **.***:***.******:***: :***:*******.*****

A0A667Y1V0_BCL2L1-      ARRAQESLRRWLLVGVVLLTGVLLGALIAKKHP
A0A667ZHE8_BCL2L1-      GRRAQESFRKWLLAGMTLVTGVVVGSLIAQKRL
                        .******:*.***.*:.*:***::*:***:*. 

© 1998-2020Legal notice