Dataset for protein Bcl-xL of organism Moschus moschiferus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C6DX24_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Moschus moschiferus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C6FN58_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Moschus moschiferus GN=BCL2L1 (length=245 residues).
MSQSNWELVVDFLSYKLSQKGYIWSQFSDMEENRTETTEGTESDMETLKAINGNPSWHLADSPAVKGATGHSRSLDARKM
IPVTTVKQALGQASNEFELRYQQTFSDLTSQLHITPGTAYQSFEQVINELLRDGVSWSRIVAFFSFGGALCMKSIDKEMQ
VLVSQVTTWMATYLNDHLEPWIQENGDWDTFVELYENNTATESQKGQERFSCWSLMDMTVWYGSAGLAFQLIITIPFVIV
IQILY
© 1998-2022Legal notice