Dataset for protein Bcl-xL of organism Moschus moschiferus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6DX24_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSA
A0A8C6FN58_BCL2L1-      MSQSNWELVVDFLSYKLSQKGYIWSQFSDMEENRTETTEGTESDMETLKA
                        *****.**************** ******:******:.********* .*

A0A8C6DX24_BCL2L1-      INGNPSWHLADSPAVNGATGHSRSLDAREVIPMAAVKQALREAGDEFELR
A0A8C6FN58_BCL2L1-      INGNPSWHLADSPAVKGATGHSRSLDARKMIPVTTVKQALGQASNEFELR
                        ***************:************::**:::***** :*.:*****

A0A8C6DX24_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A8C6FN58_BCL2L1-      YQQTFSDLTSQLHITPGTAYQSFEQVINELLRDGVSWSRIVAFFSFGGAL
                        *..:**********************:***:****.*.************

A0A8C6DX24_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A8C6FN58_BCL2L1-      CMKSIDKEMQVLVSQVTTWMATYLNDHLEPWIQENGDWDTFVELYENNTA
                        *::*:*********.::*******************.******** **:*

A0A8C6DX24_BCL2L1-      AESRKGQERFNRWFLTGMTV---------------AGVVLLGSLFSRK
A0A8C6FN58_BCL2L1-      TESQKGQERFSCWSLMDMTVWYGSAGLAFQLIITIPFVIVIQILY---
                        :**.******. * * .***               . *:::  *:   

© 1998-2022Legal notice