Dataset for protein BCL-2-like of organism Malurus cyaneus samueli

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C5TLV4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Malurus cyaneus samueli GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASEDRAPLPPGLSAPAAAAVAAAAGTSSDHTGLVSPHPEPPGSAAASHT
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C5U1E1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Malurus cyaneus samueli GN=BCL2L1 (length=230 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDDMDGVLNGSPSWHAPTSHIVNGATVHRSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C5X4L3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Malurus cyaneus samueli GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLAPAQTRVAHVLRSIASSLQEQTEEALRPLLDTIDITSVAAAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
ALFIAVVSLFREYY
© 1998-2022Legal notice