Dataset for protein BCL-2-like of organism Malurus cyaneus samueli

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5X4L3_BCL2A1-      -----------METAEFYYVYYLAQDYLQYVLQESH--------------
A0A8C5TLV4_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASEDRAPLPPGLSAPAAAA
A0A8C5U1E1_BCL2L1-      ------MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDF-------
                                    * .  :  * *:*   .:   *.               

A0A8C5X4L3_BCL2A1-      -------------------------------------------LAPAQTR
A0A8C5TLV4_BCL2-01      VAAAAGTSSDHTGLVSPHPE--------PPGSAAASHTPPAEGLRPAPQV
A0A8C5U1E1_BCL2L1-      ----AGEEDDMDGVLNGSPSWHAPTSHIVNGATVHRSSLEVHEIRRAAD-
                                                                   :  *   

A0A8C5X4L3_BCL2A1-      VAHVLRSIASSLQEQTEEALRPLLDTIDITSVAAAKRIFNGVMEEKFADG
A0A8C5TLV4_BCL2-01      VHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSR-FVAVVEELFRDG
A0A8C5U1E1_BCL2L1-      VRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQS-FEQVVNELFRDG
                        *  .**. ...:. .    :  : . : :*. :* .  *  *::* * **

A0A8C5X4L3_BCL2A1-      NTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAE
A0A8C5TLV4_BCL2-01      -VNWGRIVAFFEFGGVMCVESVNREMSPLV---DNIAAWMTEYLNRHLHN
A0A8C5U1E1_BCL2L1-      -VNWGRIVAFFSFGGALCVESVVKEMRVLV---KRIVSWMTTYLTDHLDP
                         .*****:::* *** :  :   . :   .   . *  ::* *:  :   

A0A8C5X4L3_BCL2A1-      WIDANGGWENGFLTKFER--------------------RSLLSFSKITAL
A0A8C5TLV4_BCL2-01      WIQDNGGWDA-FVELYGNSM-------RPLFDFSWISLKTILSLVLVGAC
A0A8C5U1E1_BCL2L1-      WIQENGGWER-FVDLYGNDAAAEVRKGQETFN------KWLLTGATVAGV
                        **: ****:  *:  : .                    . :*:   : . 

A0A8C5X4L3_BCL2A1-      FIAVVSLFREYY
A0A8C5TLV4_BCL2-01      ITLGAYLGHK--
A0A8C5U1E1_BCL2L1-      LLLGSLLSRK--
                        :     * .:  

© 1998-2022Legal notice