Dataset for protein Mcl-1 of organism Macaca fascicularis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A2K5W0Y7_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Macaca fascicularis GN=MCL-1 (length=267 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPRALTPDARRVARPPPI
GAEVPDVTASPARFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTP
PPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRGPRRW
HQKCAAGFCRCCWSRSWFGISNKIALL
>gnl|bcl2dbpro|A0A2K5W0Y7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Macaca fascicularis GN=MCL-1 (length=346 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPRALTPDARRVARPPPI
GAEVPDVTASPARFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTP
PPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVK
SLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDL
EGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5W0Y7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Macaca fascicularis GN=MCL-1 (length=196 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPGGRLLATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRK
LDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDG
FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|I7G687_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Macaca fascicularis GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTASPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2022Legal notice