Dataset for protein Mcl-1 of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5W0Y7_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGAT-PGGRLL--------------
A0A2K5W0Y7_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGAT-PGGRLLATEKEASARREIGG
A0A2K5W0Y7_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGAT-PGGRLLATEKEASARREIGG
I7G687_MCL1-01          MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLATEKEASARREIGG
                        *************************.*** ******              

A0A2K5W0Y7_MCL1-02      --------------------------------------------------
A0A2K5W0Y7_MCL1-03      GEAGTVIGGSAGASPR-ALTPDARRVARPPPIGAEVPDVTASPAR--FFA
A0A2K5W0Y7_MCL1-01      GEAGTVIGGSAGASPR-ALTPDARRVARPPPIGAEVPDVTASPAR--FFA
I7G687_MCL1-01          GEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFA
                                                                          

A0A2K5W0Y7_MCL1-02      --------------------------------------------------
A0A2K5W0Y7_MCL1-03      PTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2K5W0Y7_MCL1-01      PTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
I7G687_MCL1-01          PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
                                                                          

A0A2K5W0Y7_MCL1-02      ---------------------------------------ATGAKDTKPMG
A0A2K5W0Y7_MCL1-03      GNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K5W0Y7_MCL1-01      GNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
I7G687_MCL1-01          GNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
                                                               ***********

A0A2K5W0Y7_MCL1-02      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A2K5W0Y7_MCL1-03      RSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV---------------
A0A2K5W0Y7_MCL1-01      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
I7G687_MCL1-01          RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                        ****************************** :  :               

A0A2K5W0Y7_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
A0A2K5W0Y7_MCL1-03      --LPCRGPRRW---------------------HQKCAAGFCRCCWS----
A0A2K5W0Y7_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
I7G687_MCL1-01          VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
                          : . *  .*                     ::.*   :. .  .    

A0A2K5W0Y7_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K5W0Y7_MCL1-03      --RSWF---------------------------------GISNKIALL--
A0A2K5W0Y7_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
I7G687_MCL1-01          TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                          *.*:                                 *:.  :* *  

© 1998-2022Legal notice