Dataset for protein Bcl-xL of organism Lates calcarifer

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4W6BQD5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lates calcarifer GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMELNEPPNRTDGGEAGSSEEERIATHANGTFNSTSPGTPPASPLRQQRLPSTTSL
DAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIIGLFAFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A4W6EST2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lates calcarifer GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFISYKLSQRNHPTSLLRPEDAGGRTEGDKTNSAASNGLLVNSRDRCGQQGAPSPLRGGIEAVKAALRDS
ADEFELLFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKNMSELVSRIADWMTMY
LDERISPWIQSQGGWDCFAEIFGQDAAAEARRSRETMRRWLLVGVALLTGVLVGVLVAKKQ
© 1998-2020Legal notice