Dataset for protein Bcl-xL of organism Lates calcarifer

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W6BQD5_BCL2L1-      -MSQNRELVVFYIKYKLSQRNYPLNHMELNEPPNRTDGGEAGSSEEERIA
A0A4W6EST2_BCL2L1-      MSYSNRELVEFFISYKLSQRNHPTSLLRPEDAGGRTEGDKTNSAASNGLL
                           .***** *:*.*******:* . :  ::. .**:*.::.*: .: : 

A0A4W6BQD5_BCL2L1-      THANGTFNSTSPGTPPASPLRQQRLPSTTSLDAVKEALRDSANEFELRYA
A0A4W6EST2_BCL2L1-      VNSRD--RCGQQGAP--SPLR-------GGIEAVKAALRDSADEFELLFT
                        .::..  .. . *:*  ****        .::*** ******:**** ::

A0A4W6BQD5_BCL2L1-      RAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIIGLFAFGGALCV
A0A4W6EST2_BCL2L1-      QAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCV
                        .***** .** *** ***:**:.******.********:*******.***

A0A4W6BQD5_BCL2L1-      ECVEKEMSPLVGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAE
A0A4W6EST2_BCL2L1-      ECVEKNMSELVSRIADWMTMYLDERISPWIQSQGGWDCFAEIFGQDAAAE
                        *****:** **.**.:***:***:.*.*********: ************

A0A4W6BQD5_BCL2L1-      SRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A4W6EST2_BCL2L1-      ARRSRETMRRWLLVGVALLTGVLVGVLVAKKQ-
                        :***.*::..***.*::*:***:** *:*:*. 

© 1998-2020Legal notice