Dataset for protein Bcl-xL of organism Hucho hucho

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A4W5JPK5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hucho hucho GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDEAIANGSVGNNRNSRSNLAKPSSPQGGMEAVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDN
HIQPWIQSQGGWDRFAKIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|A0A4W5LYF9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hucho hucho GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGKPSSPQGGIEAVKAALRDSVDE
FELRYTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVMRIADWMATYLDN
HIQPWIQSQGGWDRFALIFGRDAAADVRRSQESLRKWLLVGVMLLSGVLVGTLIMKKCQ
>gnl|bcl2dbpro|A0A4W5NQ40_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hucho hucho GN=BCL2L1 (length=232 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHIELTEAQNRTEGGQVEGGAAVMTYVNGTVNGTSPGTPPPQQSPPSSPRRTAGL
DAVKEALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVDKEMNPLV
GRITDWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWLLAGMTLVTGVVVGSLFAQKRL
>gnl|bcl2dbpro|A0A4W5R2W6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hucho hucho GN=BCL2L1 (length=234 residues).
IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGERGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPSSPQRTM
GLDAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSP
LVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAENRKSQESFKKWLLAGMTLVTGVILGSLIAQKRL
>gnl|bcl2dbpro|A0A4W5R2W6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Hucho hucho GN=BCL2L1 (length=233 residues).
MCINLPELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGERGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPSSPQRTMG
LDAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPL
VGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAENRKSQESFKKWLLAGMTLVTGVILGSLIAQKRL
© 1998-2020Legal notice