Dataset for protein Bcl-xL of organism Hucho hucho

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W5NQ40_BCL2L1-      MMTYNNRELVVYYITYKLSQRDYPFNHIELTEAQNRTEG---GQVEGGAA
A0A4W5R2W6_BCL2L1-      IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGERGQVEGGAA
A0A4W5R2W6_BCL2L1-      -MCINLPELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGERGQVEGGAA
A0A4W5JPK5_BCL2L1-      -MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDE---------
A0A4W5LYF9_BCL2L1-      -MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDE---------
                         *  .  ****::*:*.****:*.  :: *  * .****           

A0A4W5NQ40_BCL2L1-      VMTYVNGTVNGTSPGTPPPQQSPPSSPRRTAGLDAVKEALRDSANEFELR
A0A4W5R2W6_BCL2L1-      VTTHPNGTVNGTSPGT-PPRQSPPSSPQRTMGLDAVKEALRDSANEFELR
A0A4W5R2W6_BCL2L1-      VTTHPNGTVNGTSPGT-PPRQSPPSSPQRTMGLDAVKEALRDSANEFELR
A0A4W5JPK5_BCL2L1-      --AIANGSV-GNNRNS-RSNLAKPSSPQG--GMEAVKAALRDSVDEFELR
A0A4W5LYF9_BCL2L1-      --AIANGSL-GNNRNG-RSNLGKPSSPQG--GIEAVKAALRDSVDEFELR
                          :  **:: *.. .   .. . ****.   *::*** *****.:*****

A0A4W5NQ40_BCL2L1-      YARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGAL
A0A4W5R2W6_BCL2L1-      YARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGAL
A0A4W5R2W6_BCL2L1-      YARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGAL
A0A4W5JPK5_BCL2L1-      YTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGAL
A0A4W5LYF9_BCL2L1-      YTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGAL
                        *:******.*******:***:***.*************************

A0A4W5NQ40_BCL2L1-      CVECVDKEMNPLVGRITDWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAA
A0A4W5R2W6_BCL2L1-      CVECVEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAA
A0A4W5R2W6_BCL2L1-      CVECVEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAA
A0A4W5JPK5_BCL2L1-      CVECVEKDMSPLVARIADWMTTYLDNHIQPWIQSQGGWDRFAKIFGRDAA
A0A4W5LYF9_BCL2L1-      CVECVEKDMSPLVMRIADWMATYLDNHIQPWIQSQGGWDRFALIFGRDAA
                        *****:*:*.*** **:***:.******************** *** ***

A0A4W5NQ40_BCL2L1-      AESRKSQESFKKWLLAGMTLVTGVVVGSLFAQKRL
A0A4W5R2W6_BCL2L1-      AENRKSQESFKKWLLAGMTLVTGVILGSLIAQKRL
A0A4W5R2W6_BCL2L1-      AENRKSQESFKKWLLAGMTLVTGVILGSLIAQKRL
A0A4W5JPK5_BCL2L1-      ADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
A0A4W5LYF9_BCL2L1-      ADVRRSQESLRKWLLVGVMLLSGVLVGTLIMKKCQ
                        *: *.****: ****.*: *::**::*:*: :*  

© 1998-2020Legal notice